SecReT6
Protein ID: 379704228
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4877
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]331740..334310 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDH2J1Z7
KEGG IDraq:Rahaq2_4877
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-44, Aligned region: 216..265
AAA_2 [PF07724], Evalue: 1.10E-44, Aligned region: 579..743
AAA [PF00004], Evalue: 1.10E-20, Aligned region: 216..347
AAA [PF00004], Evalue: 1.10E-20, Aligned region: 584..704
AAA_5 [PF07728], Evalue: 8.20E-18, Aligned region: 216..360
AAA_5 [PF07728], Evalue: 8.20E-18, Aligned region: 583..704
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 91..104
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 194..238
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 260..295
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 478..496
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 580..622
AAA_16 [PF13191], Evalue: 1.10E-12, Aligned region: 648..674
ClpB_D2-small [PF10431], Evalue: 6.80E-10, Aligned region: 752..823
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 99..139
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 215..313
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 334..376
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 581..601
AAA_22 [PF13401], Evalue: 4.00E-08, Aligned region: 645..677
AAA_25 [PF13481], Evalue: 7.40E-08, Aligned region: 213..240
AAA_25 [PF13481], Evalue: 7.40E-08, Aligned region: 272..312
AAA_25 [PF13481], Evalue: 7.40E-08, Aligned region: 577..604
IstB_IS21 [PF01695], Evalue: 3.10E-07, Aligned region: 196..337
IstB_IS21 [PF01695], Evalue: 3.10E-07, Aligned region: 583..601
AAA_14 [PF13173], Evalue: 4.70E-07, Aligned region: 216..350
AAA_14 [PF13173], Evalue: 4.70E-07, Aligned region: 582..678
Arch_ATPase [PF01637], Evalue: 8.00E-07, Aligned region: 195..365
Arch_ATPase [PF01637], Evalue: 8.00E-07, Aligned region: 582..599
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 217..265
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 583..619
AAA_18 [PF13238], Evalue: 2.90E-06, Aligned region: 216..248
AAA_18 [PF13238], Evalue: 2.90E-06, Aligned region: 585..613
T2SE [PF00437], Evalue: 4.30E-06, Aligned region: 115..277
T2SE [PF00437], Evalue: 4.30E-06, Aligned region: 570..661
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 215..238
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 579..605
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 216..245
NACHT [PF05729], Evalue: 1.10E-05, Aligned region: 584..603
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 216..240
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 336..362
Zeta_toxin [PF06414], Evalue: 1.60E-05, Aligned region: 582..623
Sigma54_activat [PF00158], Evalue: 2.50E-05, Aligned region: 211..234
Sigma54_activat [PF00158], Evalue: 2.50E-05, Aligned region: 581..685
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 208..232
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 577..608
Clp_N [PF02861], Evalue: 0.00026, Aligned region: 24..66
Mg_chelatase [PF01078], Evalue: 0.00034, Aligned region: 214..261
Mg_chelatase [PF01078], Evalue: 0.00034, Aligned region: 583..628
Mg_chelatase [PF01078], Evalue: 0.00034, Aligned region: 650..680
NTPase_1 [PF03266], Evalue: 0.00037, Aligned region: 216..239
NTPase_1 [PF03266], Evalue: 0.00037, Aligned region: 583..604
TIP49 [PF06068], Evalue: 0.00068, Aligned region: 216..256
TIP49 [PF06068], Evalue: 0.00068, Aligned region: 285..296
TIP49 [PF06068], Evalue: 0.00068, Aligned region: 583..618
DUF258 [PF03193], Evalue: 0.001, Aligned region: 197..236
DUF258 [PF03193], Evalue: 0.001, Aligned region: 572..595
RNA_helicase [PF00910], Evalue: 0.0015, Aligned region: 216..238
RNA_helicase [PF00910], Evalue: 0.0015, Aligned region: 584..603
RNA_helicase [PF00910], Evalue: 0.0015, Aligned region: 681..702
UPF0079 [PF02367], Evalue: 0.0024, Aligned region: 216..236
UPF0079 [PF02367], Evalue: 0.0024, Aligned region: 572..604
AAA_28 [PF13521], Evalue: 0.0043, Aligned region: 216..240
AAA_28 [PF13521], Evalue: 0.0043, Aligned region: 583..603
Protein Sequence: 856 a.a.     [Download]
>gi|379704228|ref|YP_005220602.1| type VI secretion ATPase, ClpV1 family [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MGNYLKQIVEKMNVEARECLDAAISLAVSRTHHEVDVEHLLLALMTRNPALIEQLCLSAGLRGDTLIDAL
KISLNHLRSGNTRSPVLSELLVEHLEKSWLHASACWQQTQLPVQAFLGSLIASEKDNQIHLSSALQQALL
CQTDRADRLLHDACAPAQATNHPAATRHNTDSAVMKFTRNLTEQARNASLDPALGREQEIRQLIDVLLRR
RQNNPVLTGEPGVGKTALVEGLAQRIADGTVPQALKTMEILSLDMGLLQAGASVKGEFENRLQTLLREVK
EYPSPVILFIDEAHTLIGAGGQAGQNDAANLLKPALARGEMRVVAATTWAEYKKYFEKDAALARRFQVIK
VAEPDEESATAMLRSLKPALSKHHGVQILESALVAAVRLSSRYISGRQLPDKSISLLDTACARVAISQCH
EPKEIEDLNAMIANIHTERESLLKEGDNLSRVKWLDQRESELMQSLEALLPLWRQQQQIVAQINRTEDVA
QIAALRLQLAEMHKEQAMVYDCVDATCVADVVAGWTGIPLGRMMEKEQQQLGDLVARLESRVIGQSHALA
DIAQQIRIGRANLADPVKPTGVFMLAGPSGVGKTETALALSELLFGGEQSLITINMSEYQEAHSVSGLKG
SPPGYVGYGQGGVLTEAVRRRPYSVVLLDEIEKAHPDVMEIFYQVFDKGVMEDAEGQLINFRNTLIILTS
NLASDRVMTACASGNTDQKSLTALLRPEFDQFFRPALMGRLQLIPYLPVVGETLAKIIRLKIDKVCKRFS
GAGEGHSSLSYSEKVVEFIASRCEVEQSGAREIDAVLNRELLPLLTDRLLALENKTAIRLQLGVSKGQLT
LIKQPAAKNSVAKQSV
 
Nucleotide Sequence: 2571 bp     [Download]
>gi|379703932|ref|NC_016835.1|:331740-334310 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGGGTAACTACCTGAAGCAAATTGTTGAGAAAATGAATGTCGAAGCGCGCGAGTGTCTTGACGCCGCGA
TCAGCCTGGCCGTCAGCCGTACGCATCACGAAGTAGACGTCGAGCATTTACTGCTTGCCCTGATGACCCG
CAACCCTGCGCTGATTGAGCAACTCTGTCTGAGTGCTGGCTTGCGGGGCGATACATTGATTGATGCGCTG
AAAATCAGCCTCAATCACCTGCGTAGCGGCAACACCCGCAGCCCGGTATTGTCTGAATTGCTGGTCGAAC
ATCTGGAGAAATCCTGGCTGCACGCCAGTGCCTGCTGGCAGCAAACACAACTGCCTGTACAGGCCTTTCT
GGGCAGCCTGATTGCCAGTGAAAAAGACAATCAGATCCATCTGTCATCAGCCTTACAGCAGGCGCTGCTG
TGTCAGACCGATCGCGCTGACCGGTTGTTGCACGATGCCTGCGCACCAGCACAGGCCACGAATCATCCTG
CTGCAACCCGCCACAATACTGATTCTGCGGTGATGAAATTTACCCGTAACCTGACTGAACAGGCGCGTAA
TGCGTCACTGGATCCTGCGCTGGGGCGCGAGCAGGAAATACGTCAGCTGATCGACGTGCTGTTGCGCCGC
CGTCAGAACAATCCGGTGCTGACCGGTGAGCCGGGCGTGGGGAAAACTGCGCTGGTTGAAGGGCTGGCAC
AACGTATTGCGGATGGCACCGTACCGCAAGCGTTGAAGACGATGGAGATTTTGTCGCTGGATATGGGGTT
GCTTCAGGCCGGCGCCAGCGTGAAAGGGGAATTTGAAAACCGTCTGCAAACCCTGCTGCGTGAAGTAAAA
GAATACCCGTCTCCGGTTATTCTGTTCATTGATGAGGCGCATACGCTGATTGGTGCGGGCGGTCAGGCAG
GTCAGAACGATGCCGCTAACCTGCTTAAACCGGCGCTGGCGCGAGGAGAAATGCGCGTGGTGGCAGCGAC
CACCTGGGCAGAATACAAAAAATACTTTGAGAAGGATGCCGCTCTGGCACGCCGTTTTCAGGTGATCAAA
GTGGCGGAGCCTGACGAAGAGAGCGCCACCGCCATGCTGCGTTCACTGAAACCTGCCCTCAGCAAACATC
ATGGCGTGCAGATCCTCGAAAGTGCGCTGGTGGCCGCTGTGCGTCTCTCCAGCCGCTATATTTCTGGCCG
CCAGTTGCCGGATAAATCCATTAGCCTGCTGGATACCGCCTGCGCCCGTGTGGCGATTTCACAATGTCAT
GAGCCCAAAGAGATCGAAGATCTCAATGCGATGATCGCCAACATCCACACTGAACGGGAAAGTTTACTGA
AAGAGGGCGATAACCTCTCACGGGTTAAATGGCTCGATCAACGTGAAAGCGAACTGATGCAAAGTTTAGA
AGCACTGCTGCCGCTCTGGCGTCAGCAACAGCAGATTGTGGCGCAGATTAATCGTACTGAGGATGTCGCG
CAGATTGCCGCTTTACGTCTGCAACTTGCTGAGATGCATAAAGAACAGGCGATGGTGTATGACTGTGTGG
ATGCAACCTGTGTGGCGGATGTGGTGGCTGGATGGACCGGTATTCCTCTGGGCCGGATGATGGAAAAAGA
GCAGCAACAACTCGGTGATCTGGTCGCTCGTCTGGAAAGCCGGGTGATCGGGCAATCCCATGCACTAGCG
GACATTGCGCAGCAAATCCGCATCGGACGCGCCAATCTTGCGGATCCGGTTAAACCGACCGGCGTCTTTA
TGCTGGCCGGGCCTTCCGGCGTCGGGAAAACAGAAACCGCGCTGGCCTTGTCTGAGCTGCTTTTCGGCGG
CGAACAAAGTCTAATTACCATCAATATGTCCGAATATCAGGAAGCCCATTCCGTGTCCGGCCTGAAAGGC
TCTCCGCCTGGGTACGTGGGTTACGGGCAGGGCGGTGTGCTGACCGAGGCGGTGCGCCGTCGTCCGTACA
GCGTCGTCCTGCTCGATGAAATTGAGAAAGCCCATCCGGATGTGATGGAAATTTTTTATCAGGTATTTGA
CAAAGGTGTGATGGAAGACGCCGAAGGCCAGCTGATTAATTTCCGCAACACCCTGATTATTCTGACCAGT
AATCTGGCCAGCGATCGGGTGATGACCGCCTGCGCCTCAGGAAACACTGATCAGAAATCACTGACGGCGC
TTCTGCGGCCTGAATTCGATCAATTTTTCCGTCCGGCGCTAATGGGACGGTTGCAACTGATCCCTTATCT
GCCCGTCGTGGGCGAAACACTGGCCAAAATCATCCGTCTCAAAATCGATAAAGTGTGCAAACGCTTTAGC
GGTGCTGGTGAAGGTCATTCCTCACTGAGCTACAGCGAAAAAGTGGTGGAGTTCATTGCCAGCCGCTGTG
AGGTTGAGCAAAGCGGAGCCCGCGAAATTGATGCCGTACTGAATCGGGAATTACTGCCATTACTGACTGA
CCGTTTACTGGCGCTGGAAAACAAAACCGCTATTCGCCTGCAGCTTGGGGTCAGTAAAGGTCAGCTTACG
TTGATCAAACAGCCTGCCGCGAAAAACTCAGTGGCTAAACAATCCGTCTGA