SecReT6
Protein ID: 379704229
SecReT6 ID546
T6SS typei4b
Gene symbol-
Locus tagRahaq2_4878
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]334331..335668 [+]
Producthypothetical protein
NoteTssA
UniProt IDH2J1Z8
KEGG IDraq:Rahaq2_4878
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.50E-24, Aligned region: 275..287
DUF3702 [PF12486], Evalue: 1.50E-24, Aligned region: 305..439
ImpA-rel_N [PF06812], Evalue: 2.20E-07, Aligned region: 42..102
ImpA-rel_N [PF06812], Evalue: 2.20E-07, Aligned region: 142..154
ImpA-rel_N [PF06812], Evalue: 2.20E-07, Aligned region: 234..246
Protein Sequence: 445 a.a.     [Download]
>gi|379704229|ref|YP_005220603.1| hypothetical protein Rahaq2_4878 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MKNRVNLRALKINGHDPRLSKSFLLLSSELSHLSGSLPARLDWNALEERCFQLFHEYGYDLQSGMWFCLI
NLRLKSWKGLALALDLLSTAFTHNSQRCWPPVAAVQQRQQLIDWFNANVATHIYTLEYGPENSGEMRQVE
RSIGILCGQSKNLQSRSHDSLNNLHYFLQVRCRSVPYPVQLKVTKPLPVAVENTSQPANDKKASEAVTDD
IMPHVQAPEIQLAEAPRLRPLLWGLGGMAAGIAVCAVAAAFWFSSQTRSLSEKLSAPLLALQRSERQLND
AWNNVQESELSAQKEAVLADAAPVLTWISEQPADILLRHGEILSDHLEKAYPGNEYSLQWRRTLDEKAGD
IPALDGFILANKHLDELEIRLLNAEKKHSQYMTVSELKTAVYQIRQDLQRNGTTAETLLWMMQQDKENHR
EVNPALLKQFTQRTVALNAYRFANE
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|379703932|ref|NC_016835.1|:334331-335668 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGAAAAACCGGGTGAATTTACGTGCGCTAAAAATTAACGGACATGATCCGCGTCTCAGCAAATCGTTCC
TGTTGCTGAGCAGTGAGCTGAGCCACCTGAGCGGAAGCCTGCCAGCGAGACTGGACTGGAATGCACTGGA
AGAACGTTGTTTTCAGCTATTTCATGAATACGGTTATGACCTGCAAAGCGGCATGTGGTTTTGTCTCATC
AATCTGCGGCTCAAAAGCTGGAAAGGGCTGGCGCTGGCGCTCGATCTGCTGTCGACGGCATTTACACACA
ACAGCCAGCGCTGCTGGCCGCCGGTAGCCGCCGTTCAGCAGCGTCAGCAGTTGATCGACTGGTTCAATGC
CAATGTGGCGACGCATATTTATACGCTGGAGTACGGGCCGGAAAACAGTGGGGAGATGCGTCAGGTAGAG
AGAAGTATCGGCATACTCTGCGGTCAGTCTAAAAACCTGCAATCACGCAGCCATGATTCCCTGAACAATC
TGCATTATTTCCTGCAAGTTCGCTGCCGTTCCGTGCCTTACCCGGTACAACTCAAAGTCACAAAACCCTT
GCCGGTCGCGGTGGAAAATACGTCACAACCGGCCAATGATAAAAAAGCCTCTGAAGCGGTGACCGACGAC
ATTATGCCCCATGTCCAGGCCCCGGAAATTCAGCTGGCTGAGGCACCGCGCCTGCGCCCGTTATTATGGG
GACTCGGTGGAATGGCAGCGGGCATAGCAGTTTGTGCCGTGGCAGCGGCGTTCTGGTTCTCATCACAGAC
ACGCAGTTTAAGTGAAAAGCTGAGCGCGCCGTTACTGGCATTGCAGCGAAGTGAACGTCAGTTGAATGAT
GCCTGGAATAACGTTCAAGAATCTGAACTGAGTGCGCAAAAAGAGGCGGTATTAGCCGATGCTGCGCCTG
TTCTGACGTGGATCAGTGAGCAACCGGCAGATATCCTGCTGCGCCACGGTGAAATATTGTCTGACCATCT
GGAAAAGGCATATCCGGGCAATGAATACAGCCTGCAATGGCGGCGTACATTAGATGAAAAGGCGGGGGAT
ATTCCGGCGCTGGATGGTTTTATTCTTGCAAATAAGCATCTGGATGAGCTTGAAATCCGCCTGCTGAATG
CCGAAAAGAAGCACAGCCAATATATGACCGTGTCGGAATTAAAAACGGCGGTATATCAGATACGACAAGA
TCTACAGCGTAATGGAACCACTGCTGAAACGTTATTGTGGATGATGCAGCAGGATAAGGAAAATCACCGG
GAGGTGAATCCGGCACTGTTAAAACAATTTACGCAAAGAACCGTTGCATTAAATGCGTACCGGTTTGCGA
ATGAGTAA