SecReT6
Protein ID: 379704335
SecReT6 ID547
T6SS typei2
Gene symbol-
Locus tagRahaq2_4987
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]457520..458014 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDH2J2A4
KEGG IDraq:Rahaq2_4987
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-56, Aligned region: 6..159
Protein Sequence: 164 a.a.     [Download]
>gi|379704335|ref|YP_005220709.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSNSFQNEIPKARVNIKLDLHTGGAQKKVELPLKLMVMGDYSNGKENRPLSEREKVNINKNNFNSVLAEF
SPSLNLTVENTLAGDRSEENISLNFNEMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
ETILKDPALSNELRSELNALAPKA
 
Nucleotide Sequence: 495 bp     [Download]
>gi|379703932|ref|NC_016835.1|:457520-458014 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGTCTAATAGCTTCCAGAATGAAATTCCGAAAGCGCGCGTTAACATAAAACTGGATCTACACACTGGTG
GCGCACAGAAGAAAGTCGAATTACCGTTAAAATTGATGGTAATGGGTGATTACAGTAACGGAAAAGAGAA
CCGCCCGTTATCTGAGCGCGAAAAAGTTAACATTAATAAGAATAACTTTAACAGCGTATTGGCTGAATTC
AGCCCTTCACTGAACCTGACCGTGGAAAATACGCTGGCTGGTGACCGCAGCGAAGAAAACATCTCCCTCA
ATTTCAATGAAATGAAAGATTTCGAACCGGAACAAGTTGCCCGTCAGATCCCCCAACTACGTGCGATGCT
GGCAATGCGTAACTTATTACGTGACCTCAAATCCAATCTGCTCGACAACGCCACCTTCCGTAAAGAGCTC
GAAACTATTCTGAAAGATCCTGCGCTGAGCAATGAACTGCGTAGTGAGCTGAATGCCCTGGCGCCAAAGG
CGTAA