SecReT6
Protein ID: 379704337
SecReT6 ID547
T6SS typei2
Gene symbol-
Locus tagRahaq2_4989
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]459609..460958 [+]
Producthypothetical protein
NoteTssK
UniProt IDH2J2A6
KEGG IDraq:Rahaq2_4989
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-126, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|379704337|ref|YP_005220711.1| hypothetical protein Rahaq2_4989 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MKIYRPLWSEGALLSPQQFQQQALWEAHNNQCVAHLSVVNPWGVATAEFDEGLLSVRRLQALQLTVRLPD
GSLIDTGSSDLLPPARDLSQDIPAQVNELTVMLAMPLLQANSSNVQLTDNAGDRPLRYRQEWVNVQDAFG
QEEESMAVARYALSLRFDTEQNEEYLICPVLRLVRDGQGGWRNDSTFIPPLLAMSAHHGLVLDMEQILTQ
LQAKRRRLMGMRRESNQRMADFAVADVSLFWLLNALNTHVSALSELVKNPARHPEQVWFELSKLAGSLLT
FSLEHDIEAIPAYDHASPETVFPPLLDLIGELLEASLPSRVISLEMHKINGQQWKAPLNDSRLREDADFY
LSVRSTLPAYQLISQFPALCKVGAPDDVNNIVNIALNGIPLIALSHVPAAIPLRLENQYFTMDLKHPSAQ
AMLDAGTCMFYVPELLGELQLELYAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|379703932|ref|NC_016835.1|:459609-460958 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGAAAATTTATCGACCACTATGGAGTGAGGGGGCATTGCTGTCCCCTCAGCAGTTCCAGCAGCAGGCTT
TGTGGGAAGCACATAATAATCAATGTGTTGCTCACCTGTCGGTTGTTAATCCCTGGGGTGTAGCCACAGC
TGAATTTGATGAGGGCTTGCTGAGTGTCAGACGTCTGCAAGCACTTCAACTGACCGTGCGTCTGCCTGAC
GGTTCTCTGATAGATACCGGGAGCAGCGATCTTCTCCCCCCTGCCCGGGATTTATCTCAGGATATTCCGG
CACAAGTCAATGAGCTTACGGTGATGCTGGCGATGCCGTTATTGCAGGCAAACAGCAGTAACGTACAACT
CACTGACAACGCGGGAGATCGCCCACTTCGTTATCGTCAGGAATGGGTAAATGTTCAGGATGCATTCGGT
CAGGAAGAAGAGTCCATGGCTGTGGCCCGTTACGCTTTGTCTCTGCGTTTTGACACAGAACAAAACGAGG
AATACCTGATCTGTCCTGTATTACGTCTGGTTCGCGACGGTCAAGGCGGCTGGAGAAATGACAGTACATT
TATTCCTCCGTTGCTGGCAATGTCCGCTCATCACGGGCTGGTCCTGGACATGGAGCAAATTCTCACACAA
TTGCAGGCTAAACGCCGCCGCCTGATGGGGATGCGTCGTGAGAGCAATCAGCGTATGGCCGATTTCGCCG
TCGCAGATGTGTCATTGTTCTGGCTGCTTAATGCCCTCAATACGCATGTTTCAGCATTATCTGAACTGGT
TAAAAATCCGGCGCGGCACCCTGAACAAGTCTGGTTTGAATTATCGAAACTGGCGGGGAGTCTGCTGACG
TTTTCCCTTGAACATGATATCGAGGCGATACCGGCTTACGACCACGCGTCCCCAGAGACCGTTTTCCCGC
CTTTACTTGACCTGATCGGGGAGTTACTGGAAGCCAGCCTTCCTTCGCGCGTAATCTCGCTGGAAATGCA
CAAGATCAACGGCCAGCAGTGGAAAGCGCCTCTTAATGACAGCCGCCTGCGCGAAGATGCGGACTTCTAC
CTGTCGGTGCGCTCAACACTGCCTGCTTATCAGCTGATTTCCCAGTTCCCTGCCTTATGCAAAGTCGGGG
CACCGGACGATGTCAATAATATCGTTAATATCGCACTCAATGGCATACCACTGATCGCTTTAAGCCATGT
TCCTGCTGCTATTCCTCTTCGTCTGGAAAACCAGTATTTCACAATGGATCTCAAGCATCCATCTGCGCAG
GCCATGCTGGATGCGGGTACGTGCATGTTCTATGTACCGGAACTTCTCGGTGAACTGCAACTGGAACTCT
ATGCGGTGCTTCGGTCATGA