SecReT6
Protein ID: 379704338
SecReT6 ID547
T6SS typei2
Gene symbol-
Locus tagRahaq2_4990
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]460955..461629 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDH2J2A7
KEGG IDraq:Rahaq2_4990
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.30E-47, Aligned region: 7..212
Protein Sequence: 224 a.a.     [Download]
>gi|379704338|ref|YP_005220712.1| DotU family type IV/VI secretion system protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MRNEIDIDELLADTWLSVVQLRNGVVAEEGEALYERCRAQVERVKDQLQLAGYDSESIEHITYAQCALLD
ETALGRQAEDKAPDNGHITWQRAPLQARFFGSLQAGEALYERIRSVLRQPAPDITVLTCFHRVLLLGFQG
QYSAQTINPQQREQTLTALAGRVTPFNVVLPGALLSKTGRVRGGALLRSLWFWVLVAIVIVSGVWWGGHV
WLQHLINQQLPGQF
 
Nucleotide Sequence: 675 bp     [Download]
>gi|379703932|ref|NC_016835.1|:460955-461629 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGAGAAATGAAATAGATATTGATGAGTTGCTGGCCGATACCTGGCTGTCAGTTGTGCAGTTACGTAACG
GCGTGGTTGCAGAAGAAGGCGAGGCTTTATACGAGCGCTGCCGCGCTCAGGTAGAGCGAGTTAAGGACCA
ACTACAGCTGGCCGGTTACGATAGCGAAAGCATTGAACATATCACGTATGCCCAATGTGCATTGCTGGAT
GAAACTGCACTCGGTCGTCAGGCTGAGGACAAGGCGCCTGATAACGGACATATTACCTGGCAGCGGGCAC
CGTTGCAGGCGCGTTTCTTTGGCTCTCTTCAGGCAGGTGAAGCGTTATACGAGCGGATTCGCTCTGTGCT
GCGTCAACCGGCTCCCGATATCACCGTGCTGACCTGTTTTCATCGGGTCTTATTACTGGGTTTTCAGGGG
CAATATAGTGCTCAAACAATCAACCCTCAGCAACGTGAGCAAACCCTCACCGCACTTGCCGGGCGGGTTA
CTCCTTTCAACGTGGTGCTCCCGGGTGCATTGCTGAGTAAAACAGGGCGGGTACGTGGCGGGGCATTATT
ACGCTCACTCTGGTTCTGGGTTCTGGTTGCTATTGTGATCGTGTCCGGTGTCTGGTGGGGCGGGCATGTC
TGGCTGCAACATCTGATTAATCAGCAATTGCCGGGGCAGTTCTGA