SecReT6
Protein ID: 379704339
SecReT6 ID547
T6SS typei2
Gene symbol-
Locus tagRahaq2_4991
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconplasmid pRahaq201 [GenBank: NC_016835] [Browse all T6SS(s) in this replicon]
Location [Strand]461631..463307 [+]
Productouter membrane protein/peptidoglycan-associated (lipo)protein
NoteTagL
UniProt IDH2J2A8, H2J2A8
KEGG IDraq:Rahaq2_4991
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 9.40E-16, Aligned region: 438..534
Protein Sequence: 558 a.a.     [Download]
>gi|379704339|ref|YP_005220713.1| outer membrane protein/peptidoglycan-associated (lipo)protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MRIGSRLSVYCLTGMTGCLALLLCWGFSPFAVSTKSVITLITLVLMAGFMLWGRRNHVFMDATTRLESLP
EISFSQPVVLVCGDKLDALFGETTVRVTPLACYVKTDSVKPLSIFVDAVLSQRPGWIRQMAVLYSVSPEA
HADEAVFRATIKSWRQQFYRLQKRIGCRIPVLVSCWLNGSVSPWFVGAADGKMIVRDDDEGATLLSDWLP
SSDINMQPARQSQAICLEAACSWLRDVVLDEMQHPETLSTPVCPVAVGVRFDAVSGVPDNLWSAALTRRT
TLNALMPLQSESVATLPFPDPLLPLLSGTTRHIRAGLAPVIAVILMMCFAVTAIAFVVNNNHRLITRIGM
DLKRYLVIPMSNYVPKAQAVAVLKLDAQLLERYHRQGEPLRLGLGLYQGERLWLALQQEIDRYIPPPPPP
PPAEKHTPKTVRLDALSLFDTGQYELKPGSLKMLVNALVDIKAKPGWLIVVAGHTDITGDAKANQILSLK
RAESLRDWMLSTSDVSPTCFAVQGYGATRPIATNDTPEGRAANRRVEISLVPQADACKASATPSSSND
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|379703932|ref|NC_016835.1|:461631-463307 Rahnella aquatilis CIP 78.65 = ATCC 33071 plasmid pRahaq201, complete sequence
ATGCGCATCGGTTCTCGTTTATCAGTTTACTGCCTGACCGGGATGACGGGTTGTCTGGCACTTCTGTTGT
GCTGGGGATTCAGCCCATTTGCCGTCTCCACAAAATCAGTCATTACTCTCATCACTTTGGTTCTAATGGC
AGGGTTCATGCTGTGGGGAAGGCGCAATCATGTGTTCATGGATGCGACGACACGACTGGAAAGCCTGCCG
GAGATATCGTTTTCGCAGCCGGTCGTTCTTGTTTGCGGGGACAAGCTGGATGCGCTGTTTGGTGAAACTA
CAGTACGGGTTACCCCACTTGCCTGTTATGTCAAAACAGACAGTGTAAAACCGTTATCCATTTTCGTTGA
TGCGGTGCTATCACAACGTCCCGGCTGGATCCGCCAGATGGCCGTGCTGTACAGCGTTTCTCCGGAAGCT
CATGCCGATGAAGCTGTTTTCCGTGCCACGATTAAAAGCTGGCGTCAGCAGTTTTATCGTTTGCAAAAGC
GCATCGGATGCCGCATTCCCGTGCTGGTCAGTTGCTGGCTGAACGGATCTGTATCGCCATGGTTTGTGGG
CGCTGCAGACGGGAAAATGATCGTCAGGGACGACGACGAAGGCGCAACACTGCTGAGTGACTGGTTGCCT
TCGTCAGACATCAATATGCAGCCCGCTCGCCAGTCTCAGGCTATCTGTCTTGAGGCAGCCTGTTCATGGC
TTCGGGACGTTGTGCTTGATGAAATGCAGCATCCTGAAACCCTGAGCACGCCGGTTTGTCCCGTGGCCGT
GGGTGTCAGGTTTGACGCCGTGTCGGGTGTGCCCGATAACCTTTGGTCTGCAGCATTGACGCGGCGTACC
ACACTGAATGCGCTGATGCCACTGCAATCAGAGAGCGTGGCAACTCTGCCTTTTCCCGATCCTTTGTTAC
CGCTGCTTTCCGGCACTACCCGTCATATCAGGGCAGGGCTGGCACCGGTAATAGCTGTCATTCTCATGAT
GTGTTTTGCGGTAACGGCCATTGCATTTGTCGTTAACAACAATCACCGGCTCATTACGCGTATCGGTATG
GATCTGAAGCGCTATCTGGTCATCCCAATGAGCAATTACGTTCCGAAAGCACAAGCCGTTGCCGTGCTGA
AACTGGATGCTCAGTTGCTTGAGCGTTATCACCGCCAGGGCGAGCCTTTACGTCTGGGTTTGGGACTTTA
TCAGGGTGAACGACTCTGGCTGGCTCTGCAGCAGGAAATTGATCGTTACATTCCTCCGCCACCTCCACCG
CCGCCCGCTGAAAAGCACACGCCTAAAACCGTGCGACTTGATGCCCTGTCGCTGTTTGACACCGGCCAGT
ACGAGCTTAAACCAGGCTCGCTCAAAATGCTGGTGAATGCGCTGGTGGATATCAAAGCCAAACCGGGCTG
GCTGATTGTGGTAGCCGGACACACGGATATTACCGGTGACGCCAAAGCCAACCAGATATTGTCGCTCAAA
CGCGCCGAATCACTGCGTGACTGGATGCTCTCAACCAGCGACGTTTCCCCGACCTGTTTTGCCGTGCAGG
GTTATGGCGCAACACGCCCGATTGCAACAAACGATACACCGGAAGGCCGTGCGGCCAACCGTCGTGTCGA
AATCAGTCTGGTGCCACAGGCAGATGCCTGCAAGGCATCAGCAACCCCAAGTTCATCAAATGATTGA