SecReT6
Protein ID: 379726542
SecReT6 ID772
T6SS typeii
Gene symbol-
Locus tagFTV_1623
StrainFrancisella tularensis subsp. tularensis TI0902
Repliconchromosome [GenBank: NC_016937] [Browse all T6SS(s) in this replicon]
Location [Strand]1781481..1782002 [+]
Producthypothetical protein
NoteIglG
UniProt IDH6LY84
KEGG IDftt:FTV_1290, ftt:FTV_1623
PDB IDNA
Domain hit(s) vs Pfam DUF4280 [PF14107], Evalue: 1.10E-16, Aligned region: 58..167
Protein Sequence: 173 a.a.     [Download]
>gi|379726542|ref|YP_005318728.1| hypothetical protein FTV_1623 [Francisella tularensis subsp. tularensis TI0902]
MLNIINDSLKRLEEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGAQIKCSYSLGS
GIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPWVCIPNLSAFIPTNPTTLLEN
APITTINSKAMCMFAPGGIVDFISSGQINVKTS
 
Nucleotide Sequence: 522 bp     [Download]
>gi|379725073|ref|NC_016937.1|:1781481-1782002 Francisella tularensis subsp. tularensis TI0902 chromosome, complete genome
ATGTTAAATATTATAAATGACTCCTTAAAACGCTTGGAAGAAATAACGACCAATGATGAAAGTATTAGTA
GCTCAGTATCTGATCTAGTGGCGGATTTAAACAATATAAAAATTTTATTAGCTCAATCAAAACTACACTT
ATCAAGCAATGCGTCAATATTAACCACATCAATGGGAGCACAAATTAAATGCTCATATAGTCTTGGATCA
GGAATTTATCTTAGTACAAGAATAAAAACACTAACGAACAACTTACCAGCTTCAAATATTACCGATTCTA
AACTAGGAGCTAACATTTTACCTTTTGCTGGATGTACAAATCCAGCAAACCCTACAATGAACCCATTTAG
CTTTCCTTGGGTATGTATACCAAACTTATCTGCTTTTATCCCCACGAACCCTACTACGCTACTGGAAAAT
GCTCCTATAACTACAATAAATAGTAAAGCAATGTGTATGTTTGCTCCGGGTGGTATAGTTGATTTTATTA
GTAGTGGACAAATAAATGTAAAAACATCTTAG