SecReT6
Protein ID: 383176822
SecReT6 ID538
T6SS typei1
Gene symbol-
Locus tagSSON53_01210
StrainShigella sonnei 53G
Repliconchromosome [GenBank: NC_016822] [Browse all T6SS(s) in this replicon]
Location [Strand]252925..254277 [-]
Producthypothetical protein
NoteTssA
UniProt IDE7K3I1
KEGG IDssj:SSON53_01210
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 8.40E-44, Aligned region: 137..154
DUF3702 [PF12486], Evalue: 8.40E-44, Aligned region: 292..436
ImpA-rel_N [PF06812], Evalue: 9.90E-21, Aligned region: 41..100
ImpA-rel_N [PF06812], Evalue: 9.90E-21, Aligned region: 248..264
Protein Sequence: 450 a.a.     [Download]
>gi|383176822|ref|YP_005454827.1| hypothetical protein SSON53_01210 [Shigella sonnei 53G]
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLAR
TRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERA
LQLICDKLQQVELKRVPRVENLLYFMQHTRKRLEPQPKSNAENAAQTTVRTLIYAPETLASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAA
TVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLR
GWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYHDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNVMPEAATGTTAEK
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|377520096|ref|NC_016822.1|:c254277-252925 Shigella sonnei 53G, complete genome
ATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCGCGGGCTGCCGGAATTCAGCG
CCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTGAACTGGAAACTGGTGGAGTC
GCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCACCTACTATACGCTTGCCCGG
ACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGCGGCAATGGTAAGCCACGACT
GGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGACTGGTTTAACTCCCGAACCGG
CAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGATCTACCGCACAGAGCGGGCA
TTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCCGCGCGTGGAGAATCTGCTCT
ATTTTATGCAGCACACGCGTAAACGGCTTGAACCCCAGCCGAAGAGTAACGCTGAGAACGCCGCACAGAC
CACGGTCAGAACGCTGATTTATGCCCCGGAAACACTGGCATCTTCCACACCAGAAGCGGTAGTGCCTCCC
CTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAATCCCCCACAGGCCAGTGTGA
TAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCAGTGGCTGTCGCCTCAGCATT
GTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACGACACCGCTCAGGGCGCAGCA
ACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCAACAACTTCTTGATACCTCCC
CGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGTCGCTGGCCGGAAAGCCTGCA
ACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCACAGAGTAGCCCGCAGTTGCGT
GGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGATGCAGCGCGAGAAAGAGGGAC
TAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTGGGGCAGGAAACCCCCGTTGA
GTCTCTGTTGACGCAGTACCATGATGCCCGTGCGCAGAAGCAGAATACAGATGCGCTGGAAAAACAAATT
AATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAACGTCATGCCAGAGGCGGCAA
CCGGTACCACGGCCGAAAAATAA

Protein ID: 383176823
SecReT6 ID538
T6SS typei1
Gene symbol-
Locus tagSSON53_01225
StrainShigella sonnei 53G
Repliconchromosome [GenBank: NC_016822] [Browse all T6SS(s) in this replicon]
Location [Strand]257831..259243 [-]
Producthypothetical protein
NoteTssA
UniProt IDE7K3I4
KEGG IDssj:SSON53_01225
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 152..184
Protein Sequence: 470 a.a.     [Download]
>gi|383176823|ref|YP_005454828.1| hypothetical protein SSON53_01225 [Shigella sonnei 53G]
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSLAHSQLDIPELQRRGLVILASES
KDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRFASQVIKRFETGIEVFSQNAATA
QRDALSGQLAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPVPTPAASGSSPQTTATSESGVTQP
SAPAPQIVIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSAD
MVADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRFLERLPQLTGL
LFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|377520096|ref|NC_016822.1|:c259243-257831 Shigella sonnei 53G, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGAACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGATC
GCTGGCCCACAGTCAACTGGATATCCCGGAACTCCAGCGCCGGGGGCTGGTCATTCTGGCTTCGGAGAGT
AAGGATTTTCGTCTGCTGGCGCATCTGCTAAGAACCCTGCAACACGCCGGTGATCCTCATCTCGCATTGC
GCCTGCTGGCGCTGTATGTGGAGCATTACTGGGCGGTGGCTGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGGTCATTAAACGCTTTGAAACAGGTATTGAAGTTTTTTCACAGAACGCCGCCACAGCG
CAGCGCGATGCGCTGTCAGGGCAACTGGCAAAACTGGCGCAATGCTGGCAGTCACATAACGCCCCGGAAC
TGGCACAGGCTACTGATGATCTTTTTGCCCTGTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCTGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAGACCACCGCCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGTCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCCATTTTATGTGAACGCCAGCCGGATTCACCGCAGGGCTACCGTCTGCGCCGCCATGCGCTTTG
GCAGAACATCACCAGTACGCCCCAGGCGGAAAGCGATGGCCGTACTCCACTGGCTGCGGTCTCCGCCGAT
ATGGTGGCAGATTACCATGCTCAGCTCGGTAGTGCCGATATGGCGCTGTGGCAGCAGGTGGAGAAAAGCG
TACTGCTGGCTCCTTACTGGCTGGATGGTCACTGCCTTTCTGCACAGACGGCGCTGCGTCTGGGTTACAA
ACAGGTGGCAGACGCCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCACACACCGTTTATCAGTGAGCAGACGAAACAATGGCTGGCAGCTTCGCCCGACGCCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGAAGGCAGCCAGAGCCTGTTTTGCTGAGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAAGAGGCGGGGCTGGTACAGCTTGCGCAGCAGCAGTACCGGATGTTGTTCA
GGATGGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATTCAC
GGCAGAACAATAA