SecReT6
Protein ID: 383176826
SecReT6 ID538
T6SS typei1
Gene symbol-
Locus tagSSON53_01240
StrainShigella sonnei 53G
Repliconchromosome [GenBank: NC_016822] [Browse all T6SS(s) in this replicon]
Location [Strand]262786..263547 [-]
Productputative membrane protein Aec26
NoteTssL
UniProt IDE7K3I7
KEGG IDssj:SSON53_01240
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.00E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|383176826|ref|YP_005454831.1| putative membrane protein Aec26 [Shigella sonnei 53G]
MDEGSLSLPPFTGHDEKSQRNYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWICFSLGFRGRYKVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|377520096|ref|NC_016822.1|:c263547-262786 Shigella sonnei 53G, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGACACGACGAAAAAAGCCAGCGCAACTACCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCGGCCACGCCGCTACTCGGTATGGTAATGCG
CCTTTCAACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACAGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAGCAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCAAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGCGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGATCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGCACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCTGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA