SecReT6
Protein ID: 383176830
SecReT6 ID538
T6SS typei1
Gene symbol-
Locus tagSSON53_01260
StrainShigella sonnei 53G
Repliconchromosome [GenBank: NC_016822] [Browse all T6SS(s) in this replicon]
Location [Strand]266712..267794 [-]
Producthypothetical protein
NoteTssG
UniProt IDE7K3J1
KEGG IDssj:SSON53_01260
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.90E-92, Aligned region: 33..347
Protein Sequence: 360 a.a.     [Download]
>gi|383176830|ref|YP_005454835.1| hypothetical protein SSON53_01260 [Shigella sonnei 53G]
MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAELLHRLAKGEKGTPELSLRDDPAQETL
RFSADASLAFPCSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLAHLAWKAVHEQSPVGDFLDMFSH
RLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEII
CGLVSHCFDLSEVTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSI
TSLTRKQFLSFLPSGENFLPLTMFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTPEE
RPSVTIRVRS
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|377520096|ref|NC_016822.1|:c267794-266712 Shigella sonnei 53G, complete genome
ATGGACGGAAAGAATCGGGCAGCATCCTCTTATCTGAGTCCGGGAAATCCCCCGGCAGATAAAGAGCAGA
ATGATCCGCTGGCACAGGTTTTCCATAATGCCTGCTCTTACAATTTTTTTGCGATGGCGGAGCTGTTGCA
CCGCCTGGCAAAGGGTGAAAAGGGGACGCCAGAATTATCCCTGCGCGACGATCCGGCACAGGAAACCCTG
CGTTTCAGCGCCGATGCCAGCCTTGCCTTCCCGTGCAGTGATATCAGTGCGCTGAAACGGGATACGTCAG
GGGCATTCAGGATGACCACCACCTTTATGGGGTTACAGGGGAGCCAGTCGCCTCTCCCCGGTTATTACCT
CGCTCACCTGGCCTGGAAAGCGGTACATGAACAAAGTCCGGTAGGTGATTTTCTGGATATGTTCAGCCAC
CGCCTGACCCAGTTTGTCTGGCATATCTGGCGTAAGTACCGCTATCACATCAGTTTTCGTAACGGCGGTG
TGGATGCGTTCTCGCAGCGCATGTACTCCCTTGTCGGGCTGGGCCACCGCCAGCTTCGCGATAAGCTGGC
GATTAATCACAGCAAAATGCTGGCGTATTCCGGGATCCTGGCAAATCCGGGACGATCCCCGGAAATTATC
TGTGGCCTGGTGTCCCACTGCTTTGATTTGTCAGAAGTGACACTGCAAAACTGGCAACGTCGCAAGGTGG
ATATTGAACCGGATCAGCAAAATAGTCTGGGGAGCTATTCTCTTAAAAATGGCGAAAAACTGGCGGGAAG
ATCGGTACTGGGCAACTTTGTTCTGGGTACACGAGTGCCCGATCTCAGCGGAAAATTCCAGCTCAGTATT
ACCAGCCTGACCCGAAAACAGTTCCTCTCTTTTCTGCCGTCCGGCGAAAACTTCCTGCCACTGACGATGT
TCGTGTCCTTCATCCTGCGCGATCAGCTTGCCTGGGACTTACATCTGGGGCTGGCGCCGGAGCAGGTGGG
CGCAATGCGCCTGGGCGATAACAAAAGTGCGCTGCTGGGCTGGACCAGCTTCCTCGGCACACCGGAAGAA
CGACCCTCAGTCACCATCAGGGTACGGTCGTAA