SecReT6
Protein ID: 383176833
SecReT6 ID538
T6SS typei1
Gene symbol-
Locus tagSSON53_01275
StrainShigella sonnei 53G
Repliconchromosome [GenBank: NC_016822] [Browse all T6SS(s) in this replicon]
Location [Strand]270032..270580 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDE7K3J4
KEGG IDssj:SSON53_01275
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-74, Aligned region: 2..180
Protein Sequence: 182 a.a.     [Download]
>gi|383176833|ref|YP_005454838.1| type VI secretion protein EvpB [Shigella sonnei 53G]
MKDLPMHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRKDSDNAAFFSANSVQKPKHFPGKDAE
TNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLERELNTWIRQYVADQENPPADVRSRKPLRAA
KVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLDRE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|377520096|ref|NC_016822.1|:c270580-270032 Shigella sonnei 53G, complete genome
GTGAAAGATCTGCCGATGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAAAATCCCAACCGAGGTGC
TGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTTACCATGCGTAAAGACTC
TGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTCCGGGAAAAGATGCAGAA
ACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTTAGCGCACTACATCAAGG
TGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAAAGAGAGCTTAATACCTGGAT
CCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCAGACGTGCGCAGCCGCAAACCTCTGCGCGCTGCC
AAAGTTGAGGTTATGGATGTAGAAGGCGAACCCGGCTGGTACCAGGTTGCGCTAAGCGTGAGACCTCATT
TTAAATTTATGGGGGCAAATTTTGAGCTTTCCCTGGTTGGCCGGTTAGACAGGGAGTAA