SecReT6
Protein ID: 383176839
SecReT6 ID538
T6SS typei1
Gene symbol-
Locus tagSSON53_01305
StrainShigella sonnei 53G
Repliconchromosome [GenBank: NC_016822] [Browse all T6SS(s) in this replicon]
Location [Strand]273742..275358 [+]
ProductRhs element protein
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-63, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 3.10E-27, Aligned region: 366..458
Protein Sequence: 538 a.a.     [Download]
>gi|383176839|ref|YP_005454844.1| Rhs element protein [Shigella sonnei 53G]
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLELSLVSQQFLSLEFPQVLDKMAYLTIWQGDDVQR
RVKGVVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESILATILKENGVTEWSPLFSEPH
PSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTFC
ISQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGW
RNNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASELHGEQPQAVPGRSGSGTTLNNHFAVIPA
DRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQDSSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGK
EQVYIHVQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQMQNGI
 
Nucleotide Sequence: 1617 bp     [Download]
>gi|377520096|ref|NC_016822.1|:273742-275358 Shigella sonnei 53G, complete genome
ATGTCAACCGGATTACGTTTCACGCTGGAAGTGGACGGCCTGCCACCGGATGCTTTTGCGGTGGTCTCCT
TTCATCTGAACCAGTCACTCTCTTCGCTCTTTTCCCTCGAGCTCTCTCTGGTCAGCCAGCAGTTTCTCTC
CCTTGAATTTCCGCAGGTACTGGACAAAATGGCCTACCTGACGATATGGCAGGGCGATGACGTACAGCGC
CGGGTGAAAGGTGTGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGATGCTGTACAGCATGA
AGGTATGCCCACCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGA
AAGCATCCTCGCGACGATCCTGAAGGAAAACGGTGTGACCGAGTGGAGTCCGCTGTTCAGCGAGCCGCAT
CCTTCCCGTGAGTTTTGTGTCCAGTACGGCGAAACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGG
AAGGCATCTTCTTTTATGAGGAGCACGCGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGACACCGT
GCGTTATCTGCCGGAGTCCTTTGAGATCCCCTGGAACCCGAACACCCGTACCGAGGTAAGTACCTTCTGC
ATCAGCCAGTTCCGCTACAGCGCACAAATCCGTCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAAC
GACCCGGCTGGGCAGGGCGTTTTGATCAGGAAGGCCAGTACCAGGATTACCAGCGCACACAGTATGAAGT
GTATGACTACCCCGGACGTTTCAAGGGGGCTCACGGGCAGAACTTTGCCCGCTGGCAGATGGATGGCTGG
CGCAACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCTCCGGAGATATGGCCGGGACGGCGAATTGTGC
TGACGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCAAGTGAACTGCACGGCGAGCA
GCCGCAGGCGGTGCCGGGACGCAGTGGTTCAGGAACCACGCTGAATAACCACTTTGCGGTAATACCGGCA
GACCGGACATGGCGGCCACAGCCGTTGCTGAAACCGCTGGTGGATGGCCCGCAGAGCGCCGTCGTGACGG
GACCGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGCTA
TAACCCGTCAAACCAGGACAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGATTCGGT
AACCTTGCGATACCGCGCGTGGGTCAGGAGGTCATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGA
TTATTATGGGGCGTACCTACCACCAGGAAAACCGCACACCCGGTAGCCTGCCGGGGACGAAGACGCAGAT
GACCATTCGTTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAA
GAACAGGTCTACATCCACGTGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACGGATGTGA
TAAACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATGCAAAATGG
CATCTGA