SecReT6
Protein ID: 383188508
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_0569
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]587250..587789 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH2ITP4
KEGG IDraq:Rahaq2_0569
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-35, Aligned region: 22..170
Protein Sequence: 179 a.a.     [Download]
>gi|383188508|ref|YP_005198636.1| type VI secretion lipoprotein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MSAFNSLWRYPAVVTLVFLSGLTGGCGLTQSISDGTSAMTQAIFYKQIKTLKLDFIARASVNPDEEGASL
ATDVWIYQLKDRKIFDQTDYQTLLTQASTVLKDDILAGKDIRVRPDGGATLNMPIEKEAMYVAVVAHFRT
PDLQKDSWRLVLQREELIPDAPLKIILEGNVLQLQAEKE
 
Nucleotide Sequence: 540 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c587789-587250 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGTCTGCTTTTAATTCCCTGTGGCGATATCCGGCAGTGGTGACTCTTGTGTTCTTGTCAGGGCTGACCG
GCGGATGCGGACTGACACAATCCATTTCGGATGGCACATCTGCAATGACCCAGGCCATTTTCTATAAGCA
AATTAAAACACTGAAGCTGGACTTTATCGCCCGGGCCTCAGTCAATCCCGACGAAGAAGGTGCCTCACTG
GCGACTGACGTCTGGATATATCAGCTAAAAGACCGAAAGATCTTTGATCAGACGGATTATCAGACTTTGC
TGACACAGGCCAGTACCGTGCTTAAAGACGACATATTGGCGGGGAAAGACATCCGTGTACGCCCGGACGG
CGGTGCCACGCTGAATATGCCGATAGAAAAAGAAGCGATGTATGTCGCGGTGGTTGCACATTTCAGAACA
CCCGACCTTCAGAAAGACTCCTGGCGTCTGGTTTTGCAACGGGAAGAACTCATTCCCGATGCCCCCCTGA
AAATAATCCTGGAAGGAAACGTGTTGCAGCTACAAGCAGAAAAAGAATAA