SecReT6
Protein ID: 383188509
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_0570
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]587776..588858 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDH2ITP5
KEGG IDraq:Rahaq2_0570
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-78, Aligned region: 23..322
Protein Sequence: 360 a.a.     [Download]
>gi|383188509|ref|YP_005198637.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MEREPQPVYSRLIRDMGDKLPYTNFYRFCQLIEQSSPRRPPLGSTSSPKDDLIRFRPHPGMGFPVSELKA
LECDRDHPERPPTVRTTFLGLYGVDSPLPTSYLDDIAQRREGHEAVEEFLDIFNHRIMTQFYRVWRKYSY
PASFEAGGTDETSQRLLGLMGLGIPGTAKNIATPVSRFLALLSNMRMPTRTAEGVIALVDLLSSETTASV
RLHYPRTIAIKPLRFGDKTPLGLRPVLGHSAKEVNSMFELQLYTENPAEAQAWLPGGQLSEDLLVLLRVY
LGWRVDARILLTLPRHILPPARLHTSSDGGFRGQLGYTTVMRSASTSSEVPLNATLTIRLSDYQGLKPNL
KTREVINVCF
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c588858-587776 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGGAAAGAGAACCACAGCCAGTATATTCCCGGCTGATACGGGATATGGGCGACAAATTGCCTTACACCA
ACTTTTACCGATTTTGTCAGTTGATTGAACAATCCTCCCCCCGACGCCCGCCGCTTGGCAGTACCAGTTC
CCCGAAAGATGATCTGATACGTTTTCGCCCCCATCCGGGCATGGGCTTTCCGGTCAGTGAGTTAAAAGCA
CTTGAGTGCGATCGGGATCACCCTGAACGTCCTCCCACCGTCAGAACCACTTTCCTGGGGTTGTATGGCG
TCGACTCCCCTCTGCCCACCAGCTACCTGGATGATATCGCTCAGCGCCGTGAAGGACATGAAGCAGTCGA
GGAATTTCTGGATATCTTTAATCACCGCATCATGACCCAGTTCTATCGGGTATGGCGAAAATACTCATAT
CCGGCCAGCTTCGAGGCGGGAGGCACCGATGAGACATCACAGCGCCTGCTCGGACTCATGGGTCTGGGCA
TTCCGGGGACAGCGAAAAACATTGCCACTCCGGTGTCCCGCTTTCTGGCATTACTCAGCAATATGCGGAT
GCCAACCCGTACGGCGGAAGGTGTCATCGCACTGGTTGATTTGTTGTCTTCAGAGACAACAGCCAGCGTT
CGTCTTCACTATCCGCGCACAATTGCCATTAAGCCACTGCGTTTTGGTGATAAAACGCCGCTGGGCCTGC
GGCCGGTGCTCGGTCATTCAGCCAAAGAGGTCAACAGTATGTTCGAACTGCAACTCTATACGGAAAATCC
GGCAGAGGCGCAGGCGTGGTTGCCGGGAGGTCAGTTATCGGAGGATTTACTCGTTTTGTTACGGGTATAT
CTGGGATGGCGGGTTGATGCCCGTATTCTGCTGACGCTGCCGCGTCACATCCTGCCCCCCGCCCGATTAC
ACACCTCTTCTGACGGTGGATTCAGAGGGCAACTGGGTTACACCACCGTCATGCGTTCCGCATCCACATC
ATCTGAAGTCCCGCTGAACGCCACCCTCACCATCCGGTTGAGTGACTATCAGGGGCTGAAGCCCAATCTT
AAGACCCGTGAGGTGATAAATGTCTGCTTTTAA