SecReT6
Protein ID: 383188510
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_0571
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]588822..590585 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDH2ITP6
KEGG IDraq:Rahaq2_0571
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-167, Aligned region: 6..583
Protein Sequence: 587 a.a.     [Download]
>gi|383188510|ref|YP_005198638.1| type VI secretion protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MEDLTLRYFDAEMRYLREAAKEFATAHPDRAAEIGLMTPGSADASVERLFQGFSFSMGRLREKLDDDLPE
LTEGLVSMLWPHYLRTIPSLSIVELAPAWQEMKMTETLVAHFEVISQPVGTEGTRCRYRTTRDLQLQPLI
LSHASLAMEPDGQHIIRLRFSCSRLANWQSVDLTSLPLYLNGDAPLACALLLALTHQVRKCYLRLPGQVD
RQPVTLHFKAEGLGELANLWERGDATCCGYQQLLEYFTFREKFMFVSLCGLERVELPATLAGFEVDIVLD
SPFPSDFSLDASHLRLHCVPVINLFSLDAKPLSISNQETDYLLQPLCKQPACTEIFSVDNVTSSRRTHAQ
VYTPFRTFRYHGGTLRRHLPARYYHTRVKPGVTGLHETWLILGGDGFEQERQIADETLTLSLTGTNGQLP
RLALRSTLLNATTQALPVPLNILNLCPPTMPAYPPNRDRFHWRVLSHLGTHFLSMMDNAEVLRNTLALYD
WTESEDNRRRLDAIVKVEHFRLQRFEKGLLLRGVDIEVTVESPGFYGEGDIYLFGEVLNRFLALYADIHL
FNRLTLIVQPSGKCLQWKENHSQYIPG
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c590585-588822 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGGAAGATTTAACTTTGCGATATTTCGATGCTGAAATGCGCTATCTGCGGGAAGCCGCCAAGGAGTTTG
CCACAGCACATCCTGACCGCGCAGCTGAAATAGGGCTGATGACGCCTGGCAGTGCTGACGCGTCCGTAGA
GCGACTCTTTCAGGGCTTCTCTTTCTCAATGGGACGCCTGCGGGAAAAGCTTGACGATGACCTGCCGGAA
CTCACCGAAGGCCTGGTCAGTATGCTCTGGCCGCACTATCTGAGAACTATCCCTTCGCTCTCGATAGTGG
AACTGGCTCCGGCCTGGCAGGAGATGAAAATGACGGAAACACTTGTCGCGCATTTTGAAGTCATATCGCA
GCCTGTTGGCACGGAGGGTACCCGCTGCCGCTACCGCACAACACGTGATTTACAGTTGCAACCCCTGATA
TTGTCACACGCCTCGCTGGCAATGGAGCCCGATGGACAGCACATTATCCGTCTGCGTTTTAGCTGCAGCC
GGCTGGCGAACTGGCAGTCTGTTGATCTTACCTCCCTGCCGCTCTATCTGAACGGCGATGCTCCGTTAGC
CTGCGCATTGTTGCTGGCGCTGACGCATCAGGTGAGAAAATGCTACCTGCGCCTGCCCGGACAGGTCGAC
AGGCAACCGGTCACATTACATTTTAAGGCAGAAGGATTAGGAGAACTGGCCAATCTTTGGGAACGAGGCG
ATGCGACCTGTTGCGGCTATCAACAGTTGCTGGAATATTTTACCTTCCGTGAGAAATTTATGTTCGTTTC
CCTCTGCGGGCTTGAACGGGTTGAACTGCCCGCAACCCTGGCAGGGTTTGAAGTGGACATCGTTCTCGAC
AGCCCCTTCCCCTCTGACTTCTCATTGGATGCCAGTCACTTACGGCTGCACTGTGTTCCAGTGATCAATC
TTTTCTCTCTTGATGCCAAACCGCTGAGTATCAGCAATCAGGAAACCGACTATCTGTTACAACCTCTGTG
CAAGCAGCCGGCCTGTACCGAGATATTTTCAGTCGATAATGTCACTTCATCCAGACGCACGCATGCGCAG
GTTTACACCCCTTTTCGTACTTTTCGATACCATGGCGGTACGCTGCGCCGTCACTTACCCGCCCGCTACT
ATCACACCCGCGTCAAACCGGGCGTTACCGGGCTGCATGAAACCTGGCTGATTTTAGGCGGTGACGGGTT
CGAACAGGAACGTCAGATAGCCGACGAGACGTTGACTTTAAGCCTGACCGGTACAAACGGACAGCTGCCC
CGCCTGGCACTGCGCAGCACATTACTGAATGCCACCACGCAGGCCCTGCCAGTGCCGCTTAACATACTCA
ATCTTTGCCCCCCGACCATGCCAGCCTATCCGCCAAACCGTGATCGGTTCCACTGGCGGGTTTTAAGTCA
TCTCGGCACCCATTTTTTATCAATGATGGATAACGCTGAAGTTTTGCGTAACACACTGGCGCTCTATGAC
TGGACAGAAAGTGAAGATAACCGGCGCCGTCTGGATGCCATCGTGAAGGTCGAACACTTCCGGTTACAAC
GCTTTGAAAAAGGTTTATTGCTGCGTGGCGTTGACATTGAAGTCACTGTGGAATCGCCGGGGTTTTACGG
TGAAGGGGATATTTATCTTTTTGGTGAGGTACTTAACCGCTTCCTGGCTCTTTATGCCGATATACATTTG
TTTAACCGGCTCACGCTTATCGTTCAACCCTCAGGAAAATGCCTGCAATGGAAAGAGAACCACAGCCAGT
ATATTCCCGGCTGA