SecReT6
Protein ID: 383188513
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_0574
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]595077..595346 [-]
Producthypothetical protein
NotePAAR
UniProt IDH2ITP9
KEGG IDraq:Rahaq2_0574
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.60E-18, Aligned region: 6..81
Protein Sequence: 89 a.a.     [Download]
>gi|383188513|ref|YP_005198641.1| hypothetical protein Rahaq2_0574 [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MPKGIIRLGDKLTSGGVVMSASSTMIIEGIVAALIGDVVICPLLGHGVNRIVSTTPTWLSDGKQVAFDQA
VCACGCKVLSSLPTTYIEG
 
Nucleotide Sequence: 270 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c595346-595077 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGCCAAAAGGAATTATACGGCTGGGCGATAAACTGACCAGTGGTGGCGTTGTAATGTCTGCTTCATCCA
CCATGATTATTGAAGGCATTGTTGCCGCGTTAATTGGCGATGTCGTCATTTGTCCTCTTTTAGGTCATGG
CGTCAATCGTATTGTGAGTACCACACCCACATGGCTCTCAGACGGCAAACAAGTGGCTTTCGATCAAGCC
GTCTGTGCCTGTGGCTGCAAAGTACTGAGCAGCCTACCCACTACCTATATTGAAGGATAA