SecReT6
Protein ID: 383188518
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_0579
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]601529..603901 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH2ITQ4
KEGG IDraq:Rahaq2_0579
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-61, Aligned region: 37..358
DUF2345 [PF10106], Evalue: 1.40E-49, Aligned region: 611..761
T6SS_Vgr [PF13296], Evalue: 1.00E-34, Aligned region: 315..349
T6SS_Vgr [PF13296], Evalue: 1.00E-34, Aligned region: 490..594
Phage_base_V [PF04717], Evalue: 6.20E-15, Aligned region: 409..483
Protein Sequence: 790 a.a.     [Download]
>gi|383188518|ref|YP_005198646.1| Rhs element Vgr protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MDIASSTPLNIVSSLNRYQLAVHNSTAPLDVESFVAREHLSRAYRYVVDVTSVIQDIDPQTILMQDASFI
MQSLPATAFNIFTPPQVQRTVHGVITQFARLSESRDEAHYRLTLEPHLVLLDHTRRCAIYQNMSVPEIVE
KILRDNHRYQGWQFEFRLSQSYPRRELVTQWQLSDFDFIRRLLSEVGIWFTFEMDNRLREEVVIFGDAQQ
YYQFDVKLPVKDVSGMNDNAAESVWSLSALHQIVESAVRVKDYNYRDAANTLTVENSVVSEDKTTTGNIY
HYAEGFLKTGGVQKPEPDSAGFYAFLRHERDLNDQHQLWGKTNATRLAPGQMLEIDGIIPKAYGKGILIT
GTVARASRSTSYQVTFTGIPYSETVGFRPALRARPKIIGTLPARITSISPNDIYSHIDKDGRYRLNFNFD
LDTWKDGYESPWIRLARAYAGDTYGLHLVLLAGTEVAVAFDGGHPDKPYIAHALHDSRHPDHVTIENYKR
NVLRTPANNKLRLDDERGKEHVKVATEYGKSQVSIGHLVDNKKEQRGEGFELRTDHWGAIRAAKGIFISA
DGQLQAQGKVLDMHEALDELEAAHREAISLHTAAKMAKAELADIEKQASLMNDTLKQLQQRALLLSAPAG
IAQVTPASLQLSAGENLIATAGKNADISIAQKLRIASGEILSLFAKAMGIKMFAAAGRIQIQAQSDALDM
FSKKDMSIASSDGKVTVSAKTELLLECGGGFIRIKGGNVEIGGPGSVSVKSATLQKVGPDSQNASLKLPE
HCASMIDEAAAGQGPTVSLS
 
Nucleotide Sequence: 2373 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c603901-601529 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGGATATTGCCTCCTCAACGCCACTGAACATTGTCAGCTCCCTAAACCGCTATCAGCTCGCCGTACACA
ACAGTACTGCCCCCCTCGATGTTGAGTCTTTTGTCGCCAGAGAACATCTGAGCCGGGCCTACCGTTATGT
CGTCGACGTCACCAGCGTGATTCAGGACATCGATCCGCAGACTATTCTGATGCAGGACGCCTCGTTCATC
ATGCAATCCTTACCGGCCACAGCATTCAATATTTTCACGCCGCCACAGGTACAACGCACGGTGCACGGCG
TTATCACTCAGTTTGCCCGCTTGTCAGAATCCCGCGATGAAGCACACTACCGCCTGACCCTTGAACCACA
TTTGGTCCTGCTCGACCACACACGCCGCTGCGCCATTTATCAGAACATGTCAGTACCGGAAATCGTTGAA
AAAATCTTGCGGGATAATCACCGTTATCAGGGCTGGCAGTTTGAGTTTCGTCTGAGCCAGAGTTATCCGC
GTCGTGAGTTAGTCACCCAGTGGCAACTGTCCGATTTCGACTTTATCCGCCGCCTGCTTTCCGAAGTGGG
GATCTGGTTTACTTTCGAAATGGACAACCGCCTCAGGGAAGAAGTGGTGATATTTGGCGATGCCCAGCAG
TACTACCAGTTTGATGTCAAACTGCCGGTGAAAGATGTCTCGGGCATGAACGATAACGCCGCAGAGTCCG
TCTGGTCTTTGTCAGCACTGCATCAGATCGTCGAAAGTGCCGTCAGGGTAAAGGATTACAACTATCGCGA
TGCAGCAAATACGCTGACGGTGGAAAACAGTGTGGTGTCAGAGGATAAAACCACCACTGGCAATATTTAT
CACTATGCCGAAGGCTTTCTGAAAACAGGCGGCGTACAGAAACCAGAACCGGACAGCGCCGGGTTTTATG
CCTTTCTGCGCCATGAACGTGACCTGAACGATCAGCATCAGCTATGGGGTAAAACCAACGCTACCCGACT
GGCACCGGGGCAAATGTTAGAAATCGACGGCATTATTCCGAAGGCCTACGGGAAAGGCATTCTGATCACC
GGAACCGTTGCCCGCGCATCACGAAGCACGTCCTATCAGGTGACTTTCACCGGCATTCCATACAGTGAAA
CCGTCGGATTTCGTCCTGCGTTGCGGGCGCGTCCGAAAATAATCGGCACCTTACCGGCACGTATCACCAG
TATCAGCCCGAACGACATCTACAGCCATATCGATAAAGATGGCCGCTATCGCCTGAATTTCAACTTTGAC
CTCGATACCTGGAAAGATGGCTATGAAAGCCCGTGGATACGTCTGGCCCGTGCCTATGCCGGGGATACTT
ACGGGTTACATCTGGTTTTGCTGGCAGGGACGGAAGTGGCTGTAGCCTTCGACGGCGGGCATCCCGATAA
GCCGTATATCGCTCATGCCCTTCACGACTCCCGCCACCCTGATCATGTGACTATTGAAAACTATAAACGA
AACGTACTGCGCACGCCGGCAAACAACAAACTCAGGCTCGATGACGAACGCGGTAAAGAGCATGTCAAAG
TCGCCACGGAATACGGTAAAAGTCAGGTCAGTATCGGGCACCTGGTGGATAACAAGAAAGAACAGCGTGG
TGAAGGGTTCGAACTGCGAACAGATCACTGGGGTGCCATCCGTGCCGCCAAAGGTATTTTTATCAGTGCC
GACGGTCAGCTTCAGGCGCAGGGAAAAGTTCTCGATATGCATGAAGCGCTTGACGAACTGGAAGCGGCAC
ATCGTGAAGCGATCAGCCTTCACACCGCCGCGAAAATGGCCAAAGCAGAGCTGGCCGATATCGAAAAACA
GGCCAGCCTGATGAATGACACGCTTAAACAATTACAACAGCGCGCCCTGCTTCTCTCTGCACCCGCCGGG
ATCGCGCAAGTTACCCCAGCCAGCCTGCAACTCTCCGCCGGTGAAAACCTGATTGCCACAGCAGGCAAGA
ATGCCGATATCAGCATCGCGCAAAAACTGCGTATCGCCTCAGGGGAAATTCTCAGTCTGTTCGCCAAAGC
CATGGGCATCAAAATGTTTGCCGCCGCCGGCAGGATACAGATCCAGGCGCAAAGTGATGCACTGGATATG
TTCTCGAAGAAAGACATGTCGATCGCCAGCAGCGACGGCAAAGTGACTGTTTCAGCCAAAACCGAACTGC
TGCTTGAATGCGGCGGCGGTTTTATTCGCATCAAAGGCGGTAACGTGGAAATCGGCGGGCCGGGCAGTGT
GTCGGTGAAAAGTGCCACGCTGCAAAAAGTCGGGCCGGACAGCCAGAATGCATCGCTGAAATTACCGGAA
CACTGCGCTTCGATGATAGACGAAGCGGCGGCGGGTCAGGGACCGACGGTAAGCCTGAGTTAA