SecReT6
Protein ID: 383188519
SecReT6 ID537
T6SS typeN/A
Gene symbol-
Locus tagRahaq2_0580
StrainRahnella aquatilis CIP 78.65 = ATCC 33071
Repliconchromosome [GenBank: NC_016818] [Browse all T6SS(s) in this replicon]
Location [Strand]604059..604691 [-]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDH2ITQ5
KEGG IDraq:Rahaq2_0580
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-38, Aligned region: 7..199
Protein Sequence: 210 a.a.     [Download]
>gi|383188519|ref|YP_005198647.1| DotU family type IV / VI secretion system protein [Rahnella aquatilis CIP 78.65 = ATCC 33071]
MTSIDGLLQGTWLLVISLRRNDQPTGEPFYQQGIIQVDAVRKALKDQNISVENIDHITYTQCALLDESAS
GNTRQRVVWQNQPLQVRFFQTFQAGEELYDRIRQVLQQPSPDIRVLTCFQRALALGFQGIYRDKPTPARQ
ALLNELNELVPDFDFPLNTPVIINRRFIRRGGWLRSPWLIGCGLLLITLLLSGGLNLQLEQLLHQWLPER
 
Nucleotide Sequence: 633 bp     [Download]
>gi|383187966|ref|NC_016818.1|:c604691-604059 Rahnella aquatilis CIP 78.65 = ATCC 33071 chromosome, complete genome
ATGACATCTATTGATGGATTGCTTCAGGGCACCTGGTTACTGGTTATATCGCTAAGACGAAACGATCAGC
CGACAGGGGAACCTTTTTATCAGCAGGGCATTATTCAGGTTGATGCGGTACGTAAAGCACTTAAAGACCA
AAATATCTCGGTTGAGAATATTGATCATATCACTTACACACAATGTGCTTTGCTTGATGAATCCGCTTCA
GGAAATACCCGTCAACGTGTCGTCTGGCAGAATCAGCCCCTGCAAGTTCGTTTCTTTCAGACATTCCAGG
CTGGCGAAGAGCTGTATGACCGCATTCGTCAGGTACTGCAGCAGCCTTCGCCCGATATCCGCGTCCTGAC
GTGTTTTCAACGTGCACTGGCGCTCGGATTTCAGGGCATCTATCGCGATAAGCCAACCCCTGCCCGTCAG
GCACTTCTCAATGAACTCAACGAATTAGTTCCTGACTTTGATTTCCCTCTGAATACGCCGGTAATCATAA
ACCGCCGCTTTATCAGGCGCGGTGGCTGGTTGCGTTCTCCCTGGTTAATCGGATGTGGACTGCTGCTGAT
AACGCTGCTTCTGAGCGGAGGGCTGAACCTGCAACTGGAACAGTTATTACATCAGTGGCTACCCGAAAGA
TAG