SecReT6
Protein ID: 383317028
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1783
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1895642..1896700 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDH8KZE6
KEGG IDfau:Fraau_1783
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-20, Aligned region: 50..109
Protein Sequence: 352 a.a.     [Download]
>gi|383317028|ref|YP_005377870.1| type VI secretion-associated protein, ImpA family [Frateuria aurantia DSM 6220]
MNEFPAIKDMASSCGEDLEYAPEFVALQQASIGKSEQQFGTAIIPAEPPDWHRIEDEARQLLRRSQDIRI
LGLLTLAWTENEGIAGYARGLQWLAELLEQHWEAVHPRLQTADEYDPMQRVNAIAAFADTVSLARSLRKS
ALLAGSSGHLSLRDAAAILEGGDSSENLGYPGGSVRLRAELGQARGDTAATLIAVDQILASVSRVRQVME
KHLDTAWMPSFAPIEQPLNTISAAVSVRRGLHEISGQALSVAPPSVAEAEEAAAPDLGAGTGLPAGHIDG
RDEVIRMLQQACDYLERSEPSHPAPMLIRRSLRLLQMNFYEIVRELMPEGLSRLDALAGTGNRDGASPPA
KD
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1895642-1896700 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGAATGAATTTCCTGCCATCAAGGACATGGCCTCCTCCTGCGGTGAAGATCTTGAATATGCTCCCGAGT
TCGTGGCCCTGCAGCAGGCATCGATAGGCAAGAGCGAGCAGCAGTTCGGCACGGCGATCATTCCGGCCGA
ACCGCCTGACTGGCACCGGATCGAGGATGAGGCGCGGCAACTGCTGCGGCGCAGTCAGGATATTCGCATT
CTAGGCCTGTTGACCCTGGCCTGGACCGAAAACGAAGGTATCGCCGGTTATGCGCGGGGTCTGCAATGGT
TGGCTGAGCTGCTGGAGCAGCACTGGGAAGCGGTGCATCCGCGACTGCAGACGGCTGACGAATATGATCC
GATGCAGCGCGTCAATGCGATCGCGGCTTTTGCCGACACCGTGTCGCTGGCCCGCAGCCTGCGCAAGTCG
GCCTTGCTGGCCGGATCTTCCGGGCATCTGAGTCTGCGGGATGCGGCGGCGATACTGGAGGGCGGTGACA
GTTCAGAAAACCTTGGCTATCCAGGGGGCAGTGTGCGCCTGCGGGCCGAGCTTGGACAGGCGCGCGGCGA
TACGGCTGCGACCTTGATCGCCGTGGACCAGATACTGGCGAGCGTGAGCAGGGTTCGTCAGGTCATGGAA
AAGCATCTCGATACGGCCTGGATGCCGTCGTTTGCACCGATCGAGCAGCCTCTGAACACGATTTCTGCTG
CCGTCTCGGTACGTCGGGGGTTGCATGAAATCAGTGGCCAGGCCTTGAGTGTGGCGCCGCCTTCAGTGGC
CGAGGCAGAGGAGGCGGCTGCGCCAGACCTTGGCGCTGGCACAGGGCTTCCGGCTGGCCACATTGATGGA
CGCGACGAGGTGATCCGCATGCTGCAGCAGGCTTGCGACTATCTGGAACGCAGCGAGCCCAGCCATCCTG
CACCGATGCTGATCCGCCGTTCGTTGCGACTGTTGCAGATGAATTTCTACGAAATCGTCCGTGAACTGAT
GCCCGAGGGGCTGTCCCGACTGGATGCGCTGGCAGGTACCGGTAACCGCGATGGCGCCAGCCCGCCAGCG
AAGGACTGA