SecReT6
Protein ID: 383317029
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1784
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1896757..1897386 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDH8KZE7
KEGG IDfau:Fraau_1784
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-53, Aligned region: 17..170
Protein Sequence: 209 a.a.     [Download]
>gi|383317029|ref|YP_005377871.1| type VI secretion protein [Frateuria aurantia DSM 6220]
MANLKTLKPRSGGQKFIGRNRAPRVQIEYDVEIYGSERKVEIPFVMGVMADLAGKSLVPQPDLDQRRLLE
IDIDNFDDRLKAIQPRVAFHVPNLVDGDGLLPVDIGFESMGDFSPAQVARKVESLNYLLEARTQLSNLLS
YVDGKSGAEALLAQALEDRGLLQALASEVPAEAEAETVDSRGQAAAAEVGPDAPADGEADASGPLDIEP
 
Nucleotide Sequence: 630 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1896757-1897386 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGGCCAATCTCAAGACACTCAAACCCCGCTCCGGCGGGCAGAAGTTCATCGGCAGGAATCGGGCGCCCC
GTGTCCAGATCGAATATGACGTTGAAATCTACGGTAGCGAGCGCAAGGTGGAAATCCCGTTCGTGATGGG
CGTGATGGCGGATCTGGCCGGCAAGAGTCTGGTACCGCAACCGGATCTGGATCAACGCCGGCTGCTGGAG
ATCGACATCGACAATTTCGATGACCGTCTGAAAGCAATACAGCCGCGCGTGGCCTTCCATGTGCCCAATC
TCGTCGATGGCGACGGACTGTTGCCGGTGGATATCGGTTTTGAAAGCATGGGGGATTTCTCGCCTGCCCA
GGTGGCTCGCAAGGTCGAGTCGCTCAACTATCTGCTGGAAGCACGGACCCAGCTTTCCAATCTGCTGTCC
TATGTCGACGGAAAAAGCGGTGCCGAGGCGCTGCTGGCACAGGCTCTCGAGGACAGGGGCCTGCTGCAGG
CGCTGGCCAGTGAGGTTCCTGCCGAGGCGGAGGCTGAGACGGTGGATAGCCGGGGCCAGGCTGCTGCCGC
TGAAGTGGGTCCGGATGCCCCTGCCGATGGCGAAGCCGATGCCTCGGGACCATTGGACATCGAGCCCTGA