SecReT6
Protein ID: 383317030
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1785
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1897411..1898949 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDH8KZE8
KEGG IDfau:Fraau_1785
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-193, Aligned region: 69..494
Protein Sequence: 512 a.a.     [Download]
>gi|383317030|ref|YP_005377872.1| type VI secretion protein EvpB [Frateuria aurantia DSM 6220]
MTTPKPLPTATITPVVPATALDFNRQLQAELRPRTDQARQAIDTAVRVLASQAMRHTVTISTDAYQTIQG
IIAEIDRKLTDQINAIIHHPEFQQVESAWRGLSYLVNHTETDELLKIRFLPISKKELSRVLKRYKGVGWD
QSPIFKKVYEEEYGQFGGEPLGCLVGDFYFDHSPPDLETLGELAKVAASAHCPFIAGAAPSIMQMESWQE
LSNPRDLTKIFQNTEYATWRSLRESDDSRYVGLAMPRFLARLPYGARTNPIDEFDFEEDTDDANHDRYSW
INSAYAMAANINRSFKYYGWCTSIRGVESGGAVQDLPTHTFPTDDGGIDMKCPTEIAISDRREAELAKNG
FMPFVHRKNSDFAAFIGAQSLQKPHEYYDPDATDNARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERS
DMERWLNDWIMNYVDGDPINSSQETKAKKPLAAAEVVVEEIDDNPGYYSAKFFLRPHYQLEGLTVSLRLV
SKLPSLKESDTQTAHYLPSQSR
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1897411-1898949 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGACCACGCCCAAACCATTGCCTACCGCCACCATCACGCCCGTCGTCCCTGCGACCGCGCTGGACTTCA
ACCGGCAGCTGCAGGCCGAGCTGAGGCCGCGTACCGATCAGGCTCGCCAGGCCATCGACACTGCCGTGCG
GGTGCTGGCCAGTCAGGCCATGCGCCATACCGTAACGATCTCCACCGATGCCTACCAGACCATCCAGGGC
ATCATCGCCGAGATCGATCGCAAGTTGACCGACCAGATCAATGCCATCATCCATCATCCGGAATTCCAGC
AGGTCGAGTCCGCCTGGCGCGGGCTGAGCTATCTGGTCAATCACACCGAAACCGACGAGTTGCTGAAGAT
CCGTTTTCTGCCGATCTCAAAGAAGGAACTCAGTCGAGTCTTGAAGCGATACAAGGGTGTGGGCTGGGAT
CAAAGCCCCATTTTCAAGAAAGTCTATGAAGAGGAATATGGCCAGTTCGGTGGCGAACCTCTGGGTTGTC
TGGTCGGTGACTTCTATTTCGACCACAGTCCACCGGATCTGGAAACGCTGGGGGAGCTGGCCAAGGTGGC
AGCCTCCGCACATTGCCCGTTTATCGCGGGTGCAGCGCCTTCCATCATGCAGATGGAGTCCTGGCAGGAA
CTGTCGAATCCGCGTGATCTGACCAAGATCTTCCAGAACACCGAATATGCCACCTGGCGCTCCCTGCGGG
AATCGGATGACTCCCGTTATGTCGGTCTGGCGATGCCGCGCTTCCTGGCCCGGCTGCCGTATGGTGCGCG
CACCAATCCCATCGACGAGTTCGATTTCGAAGAAGATACCGACGATGCCAATCATGATCGCTACAGCTGG
ATCAACTCGGCCTATGCGATGGCAGCCAATATCAATCGCTCGTTCAAATACTACGGTTGGTGCACCTCGA
TTCGCGGCGTGGAGTCCGGTGGTGCGGTACAGGATCTGCCGACCCATACCTTTCCCACTGACGATGGCGG
CATTGACATGAAATGCCCCACCGAAATCGCGATCAGCGATCGGCGCGAGGCCGAACTTGCAAAGAACGGC
TTCATGCCTTTCGTACATCGCAAGAATTCGGATTTTGCAGCCTTTATCGGCGCTCAGTCATTGCAGAAGC
CCCACGAGTACTATGATCCGGATGCCACCGACAATGCGCGGCTGGCTGCACGGCTGCCCTATCTGTTCGC
ATGCTGCCGTTTCGCCCATTATCTGAAATGCATCGTTCGCGACAAGATCGGTTCTTTCCGCGAGCGCAGT
GACATGGAGCGCTGGCTGAACGACTGGATCATGAATTATGTCGACGGCGACCCGATCAATTCCTCCCAGG
AAACCAAAGCCAAGAAACCGCTGGCGGCGGCCGAGGTGGTGGTCGAGGAAATCGATGACAACCCCGGCTA
TTACAGCGCGAAGTTCTTCTTGCGCCCGCATTACCAACTTGAAGGTCTGACGGTATCGCTGCGGCTGGTG
TCCAAGCTGCCATCCCTGAAGGAGAGCGATACCCAGACCGCCCATTATCTACCATCCCAATCACGTTGA