SecReT6
Protein ID: 383317031
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1786
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1898974..1899456 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDH8KZE9
KEGG IDfau:Fraau_1786
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-35, Aligned region: 6..135
DUF796 [PF05638], Evalue: 1.10E-35, Aligned region: 137..157
Protein Sequence: 160 a.a.     [Download]
>gi|383317031|ref|YP_005377873.1| hemolysin-coregulated protein [Frateuria aurantia DSM 6220]
MAVDMYMRVDGVQGESKDSNHRHWTNIQSYAWGATQPGNMATGSGGGVGKASFSDLHVVAVIDKAAPAIL
KYCANGRHLPQVEISVCKAGGTQIEYLRITLSEVLVTSVQQGASKDSDAVSVDYAFQAANVKKQYWEQTD
QGTKGSESVLAWNIKENREV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1898974-1899456 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGGCAGTTGACATGTACATGCGGGTCGATGGCGTTCAGGGAGAATCCAAGGATTCCAATCATCGGCATT
GGACCAATATTCAATCCTATGCCTGGGGCGCGACCCAGCCTGGCAATATGGCGACCGGCAGCGGTGGCGG
AGTAGGCAAGGCCAGCTTCAGTGATCTGCACGTGGTGGCCGTCATCGACAAGGCGGCGCCAGCCATCTTG
AAATATTGCGCCAATGGCCGACATCTTCCTCAGGTGGAAATTTCTGTATGCAAGGCCGGCGGCACCCAGA
TCGAATATCTGCGGATCACCTTGTCTGAAGTGCTGGTGACCTCGGTGCAACAGGGCGCTTCCAAAGACTC
CGATGCGGTTTCAGTGGATTACGCCTTCCAGGCGGCCAATGTGAAGAAACAGTACTGGGAGCAGACGGAC
CAGGGGACCAAGGGCAGCGAGAGCGTCCTGGCCTGGAACATCAAGGAGAACCGGGAAGTCTGA