SecReT6
Protein ID: 383317032
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1787
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1899602..1900150 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDH8KZF0
KEGG IDfau:Fraau_1787
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.20E-19, Aligned region: 49..158
Protein Sequence: 182 a.a.     [Download]
>gi|383317032|ref|YP_005377874.1| type VI secretion system lysozyme-like protein [Frateuria aurantia DSM 6220]
MARSSPLHAQRKPSTLQPCGRELQPVLLERLTDDRVDQRREPDGAFLLTRTMLRESVLRDLRWLLNTIHM
ESTDDLAAFGQVRQSVLNYGIGALAGQLIAELEWSDIESSIREAIVQFEPRILADSLRVRCLADNLNHDH
HNILSLELSGELWCIPYPLEFIFRSEIDLECGYIVLRSLGAE
 
Nucleotide Sequence: 549 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1899602-1900150 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGGCGCGATCCTCACCCTTGCATGCACAGCGCAAACCGTCGACGCTCCAGCCCTGTGGGCGCGAATTGC
AACCGGTATTGCTTGAGCGTCTGACGGATGACAGGGTCGATCAGCGACGGGAGCCTGACGGTGCCTTTCT
GTTGACCCGGACCATGCTGCGTGAATCCGTGCTGCGGGATTTGCGGTGGTTGCTGAACACCATCCACATG
GAGTCCACTGATGATCTGGCTGCCTTTGGCCAGGTCCGGCAGTCGGTACTCAATTACGGTATAGGCGCCC
TGGCCGGGCAGCTGATTGCCGAACTGGAATGGTCGGACATCGAAAGCAGCATCCGGGAGGCGATTGTCCA
GTTCGAGCCCAGGATACTGGCAGACAGCCTGCGCGTGCGCTGTCTGGCCGACAACCTCAATCATGACCAC
CACAACATCTTGTCGCTGGAACTCAGCGGCGAGTTATGGTGCATCCCTTATCCCCTGGAATTCATTTTCC
GTTCTGAAATCGATCTGGAATGCGGTTATATCGTCCTGCGTTCCTTGGGGGCAGAGTGA