SecReT6
Protein ID: 383317033
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1788
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1900150..1902012 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDH8KZF1
KEGG IDfau:Fraau_1788
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-209, Aligned region: 5..619
Protein Sequence: 620 a.a.     [Download]
>gi|383317033|ref|YP_005377875.1| type VI secretion protein [Frateuria aurantia DSM 6220]
MDSRLLDYYNRELTYFREMGAEFAREYPKVAGRLGLRGTEVPDPYVERLLEGVSFLTARIQLKMDAEFPR
FSQRLLDIVCPHYLAPTPAMGIVQIEPGYREGSLLQGYVLPAGTSLRAHLSRGEQTACEFRTAHEVQLWP
LKLQVLGGEAELADLSLASWPLPAEVRSVLRLRLDGVGVSQLRSLPLKKLSFHLCGEERHALMLLEQILA
HGIGVVARAPDARAARLLPASVIRPCGMDPEQALLPCDRRVFQGYRLLHEYFAFPARFLFFDIEQMERAL
IDIEGPSLELDILFDRSWPDVESAVGPDSLALYCTPVVNLFEKRSDRIAVSSQRYEQHLVIDRTRPMDYE
IYSVNKVVGHRREGGEELSFRPFYGNVSGDPALAAYFSTRREPRLVPEQKSRGGSRTGYLGSEVFLSLVD
QNEAPYPDDLRTVAIEALCTNRDLPLLLPLQEASDFSLRVSAPAGRIKLLRGPTPPRAAVVEGEATWRLI
SHLNINYLSLTDLDGESGAQAMRELLQLYAGLAGPALQQQIKGIRSMRVEPTHQQLPQPGPIVFGRGVKV
TMRLDLTAFSGTGVYLFGAVMEQFLARHVSINSFVELQLLILQTGEVLRWAPRIGRRPSV
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1900150-1902012 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGGACAGTCGCCTGCTGGATTACTACAACCGCGAACTCACCTATTTCCGGGAGATGGGGGCGGAATTTG
CGCGCGAGTATCCCAAGGTGGCTGGCCGCCTCGGCTTGCGCGGCACCGAGGTGCCCGACCCGTATGTCGA
GCGACTGCTGGAAGGCGTCAGCTTTCTGACCGCACGCATCCAACTGAAGATGGATGCTGAATTTCCCCGT
TTTTCGCAACGGCTGCTCGATATCGTTTGTCCGCACTATCTGGCACCGACGCCGGCGATGGGCATTGTCC
AGATCGAGCCCGGCTATCGCGAGGGCAGCCTGCTGCAGGGCTATGTCTTGCCGGCCGGGACTTCGCTGCG
GGCACATCTCAGCCGCGGCGAGCAGACCGCCTGCGAGTTCAGAACGGCTCATGAGGTGCAATTGTGGCCA
TTGAAGTTGCAGGTCCTGGGCGGAGAGGCCGAGCTGGCGGATCTGTCGCTGGCTTCCTGGCCCCTGCCAG
CCGAGGTTCGCAGTGTACTGAGATTGCGCCTTGATGGTGTAGGGGTGTCGCAGCTCCGCAGTCTGCCGCT
GAAAAAACTCAGCTTTCATCTGTGCGGCGAAGAGCGTCATGCCTTGATGCTGCTGGAGCAGATTCTGGCT
CATGGCATCGGCGTGGTGGCACGGGCGCCGGATGCGCGGGCTGCGCGTCTGCTGCCTGCCTCGGTGATCC
GTCCCTGCGGTATGGACCCGGAGCAGGCGCTGCTGCCCTGTGACCGGCGGGTCTTTCAGGGCTACCGCCT
GCTGCACGAATATTTTGCCTTTCCTGCCCGCTTCCTGTTCTTCGATATCGAACAGATGGAGCGGGCCCTG
ATCGATATCGAAGGGCCGTCATTGGAGCTGGACATTCTGTTCGACCGGTCCTGGCCCGATGTCGAATCGG
CCGTGGGGCCGGATAGTCTGGCTCTTTATTGCACACCGGTAGTGAATCTGTTCGAAAAGCGATCAGATCG
TATCGCGGTCTCCAGTCAGCGTTACGAGCAGCATCTGGTGATTGACCGTACCCGGCCGATGGACTACGAA
ATCTACTCGGTCAACAAGGTTGTCGGCCATCGACGCGAGGGCGGCGAAGAGCTTTCTTTCCGGCCCTTCT
ATGGCAATGTCAGTGGTGATCCGGCCCTGGCCGCGTATTTTTCCACGCGGCGGGAGCCCCGGCTGGTGCC
AGAGCAGAAAAGTCGTGGCGGCAGTCGTACCGGCTATCTGGGCAGCGAGGTGTTCCTGTCGCTGGTTGAT
CAAAACGAGGCTCCCTATCCCGATGATCTGCGTACCGTCGCGATCGAGGCACTGTGCACCAATCGGGATC
TGCCCTTGCTGCTGCCGCTGCAGGAGGCCTCGGATTTCAGTCTGCGGGTTTCGGCTCCGGCGGGCCGGAT
CAAGCTGCTGCGTGGGCCGACGCCCCCCCGTGCGGCGGTGGTGGAGGGCGAAGCCACCTGGCGATTGATC
AGCCATCTGAATATCAATTATCTCAGTCTGACCGATCTGGACGGGGAGAGCGGTGCCCAGGCCATGCGGG
AATTGCTGCAGCTCTATGCCGGTCTGGCGGGTCCCGCTCTTCAGCAGCAGATCAAGGGGATCCGCAGCAT
GCGGGTCGAACCGACCCATCAGCAATTGCCGCAGCCGGGACCCATCGTCTTCGGTCGTGGCGTGAAGGTC
ACGATGCGTCTGGATCTGACGGCCTTTTCCGGAACAGGGGTGTATCTGTTCGGTGCAGTGATGGAGCAGT
TTCTGGCCCGGCATGTCTCGATCAACAGTTTCGTCGAGCTGCAGCTCTTGATCCTGCAGACCGGCGAAGT
GCTGCGCTGGGCACCTCGTATCGGCCGGCGGCCCAGCGTATGA