SecReT6
Protein ID: 383317034
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1789
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1902009..1903199 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDH8KZF2
KEGG IDfau:Fraau_1789
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.40E-95, Aligned region: 25..328
Protein Sequence: 396 a.a.     [Download]
>gi|383317034|ref|YP_005377876.1| type VI secretion protein [Frateuria aurantia DSM 6220]
MSAIRQAPAEASAQGLEAFWQQLAQTPYAFDLYHLLRWLDARGDHTVLLGRAARSKGELLRLGQEPSMAF
APSTLASVKPRHGPGLPKVSIFSFGLFGPNGPLPLHLTEFARDRQRNYGDDTLSAFADIFHHRLILLFYR
AWADAQATASLDRPDTARFDRHVASLIHLGLPAQRHRDTVPDHVRYFFAGHQVRLSRNPEGLLQMLRGHL
QIPVELAEYMPHWIGVTGGSRACLTSRAPALAGGALLGLAVRDVQSSFRLILGPLSWSQYRQFLPLAAGT
RLVVDWVRHYLGVELQWDLLLRLAADEVPALRLGEIEVALGWGSWLGRRLTSRSADDLLFCPEDWRSRSD
RAHRSRAGSEEVASELQIQSRRNDDTARSPRVAPDQPDDHSQAGIT
 
Nucleotide Sequence: 1191 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1902009-1903199 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGAGTGCCATCCGGCAAGCCCCGGCCGAGGCATCAGCGCAGGGTCTGGAAGCCTTTTGGCAGCAACTGG
CGCAGACACCGTATGCCTTCGACCTCTATCATCTGCTGCGCTGGCTGGATGCGCGTGGCGACCATACCGT
GCTGCTCGGCCGCGCCGCTCGCAGCAAGGGTGAGCTCCTGCGACTGGGGCAGGAGCCGTCCATGGCATTC
GCGCCTTCGACACTGGCCTCGGTAAAGCCCCGCCACGGGCCGGGACTGCCCAAGGTATCGATCTTCAGCT
TCGGCCTGTTCGGTCCCAATGGCCCCTTGCCCCTGCATCTCACCGAATTCGCGCGAGATCGGCAGCGCAA
TTACGGCGATGACACCTTGTCGGCCTTTGCCGACATCTTCCACCATCGGCTGATCCTGCTGTTCTATCGC
GCCTGGGCGGATGCGCAGGCCACGGCGAGTCTGGATCGGCCCGATACGGCTCGCTTCGACCGTCATGTCG
CTTCGCTGATACACCTCGGGCTGCCGGCCCAGCGGCACCGCGATACGGTCCCCGACCATGTTCGCTATTT
CTTCGCCGGCCATCAGGTCCGGCTTTCGCGCAACCCGGAAGGGTTGTTGCAGATGCTGCGCGGCCACTTG
CAGATACCGGTGGAATTGGCCGAGTACATGCCCCATTGGATCGGTGTCACGGGGGGCAGTCGTGCCTGCC
TGACGAGCCGGGCTCCCGCGCTGGCGGGAGGCGCGCTGCTGGGCCTGGCCGTACGTGACGTGCAATCCAG
CTTCCGGTTGATACTGGGGCCGCTCAGCTGGTCGCAGTATCGGCAGTTTCTGCCCCTGGCCGCCGGGACC
CGGCTGGTGGTGGACTGGGTCCGGCATTATCTGGGCGTGGAATTGCAGTGGGATTTGCTGCTGCGGCTTG
CGGCCGATGAGGTTCCGGCCTTGCGGCTGGGCGAGATCGAGGTCGCCCTGGGCTGGGGCAGCTGGCTGGG
GCGTCGCCTCACATCGCGATCAGCCGATGATCTTCTGTTCTGCCCCGAAGACTGGCGGTCACGCAGTGAC
CGGGCACATCGCAGCCGAGCCGGCTCCGAGGAGGTGGCGAGCGAGCTGCAGATCCAGTCACGTCGGAATG
ATGATACGGCGCGATCGCCAAGAGTCGCACCGGATCAGCCGGATGACCATTCTCAAGCGGGTATCACCTA
A