SecReT6
Protein ID: 383317035
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1790
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1903215..1905731 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDH8KZF3
KEGG IDfau:Fraau_1790
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.10E-80, Aligned region: 25..330
Phage_base_V [PF04717], Evalue: 9.60E-23, Aligned region: 274..291
Phage_base_V [PF04717], Evalue: 9.60E-23, Aligned region: 366..458
Protein Sequence: 838 a.a.     [Download]
>gi|383317035|ref|YP_005377877.1| Rhs element Vgr protein [Frateuria aurantia DSM 6220]
MNHVVVAHTPLAPSALKFRLLTGEETLSSLYQFAVEFIADTASLDMTQLLGQPVTLEIQTHPGGTRWLGG
QVVRCELTGRETHTPRSYVYTATLRPWLWYLTRTTDCRIFQNKNVRDIIGEVLAPYGFPFEFRLGAQYRE
WEYCVQYQESHFDFISRLMEQEGMYYYFEHAQGQQTLILADDLSAHANLPDYAVLPYLAPDRLVLPDEEG
IDSWQSAVEIRSGGYAVDDYDFKKPKANLGQVRNQQLIDGLHGQYQKYIWHGGYIDADQGLHYARVRLEE
EQAEHARVRAHTKIRGIAPGYLFNLKHCPRRSENREYLIVGVNYHFQEGGYATGSSDSFYDFHFVVQPSD
VPYRAPCITPVPRATGPQTAVVVGPPGQEIWTDRYARVKLQFRWDRYGQSNENSSCWVRVSDSWAGTNFG
GIYIPRVGQEVVVDFLNGELDRPLITGRIYNADQMPPFGLPESATQSGFVTRTPGGSAANANILRFEDKK
GAEQVKLHAERNYDISVEHDATKSVANKYLLQVGFLQLPPESQQSPLPRMNQVLPGAVTAGGQQQQPHNT
APAPVIPMPAQFQQQTPGDLVQAFAQNITSAIQYVASAVGNASAKVYGVTVEGLAATVIFGEDFSVVTGD
TSGFVNGNQLTEVNGNNTTLIVGDNFSTIIGNHFSNVEGNSTSNVIGNNLSHVGGNSESVVDANTLSVVG
VNSTSEIGNDSTSQIGANASTFIGADSLTEVAGNSTSLIAVNSLSVVGAAQESIVPQTMTINGSAVSVVG
SSVSTTGSAISMTGSSVANTGSSVANTGSSVSSTGSSIASTGFAQSNTGMQLSVVGMQITIVGQSITL
 
Nucleotide Sequence: 2517 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1903215-1905731 Frateuria aurantia DSM 6220 chromosome, complete genome
GTGAACCATGTCGTCGTTGCACATACCCCCCTGGCCCCTTCGGCGCTGAAATTCAGGCTGCTGACAGGCG
AAGAGACGCTGTCCTCGCTGTACCAGTTTGCGGTGGAATTCATTGCCGATACCGCCTCGCTGGACATGAC
CCAGCTGTTGGGACAGCCGGTGACTCTGGAAATCCAGACCCATCCCGGCGGGACGCGCTGGCTGGGCGGC
CAGGTCGTCCGCTGCGAACTGACCGGGCGCGAGACCCATACCCCGCGCAGTTACGTCTACACGGCCACCT
TGCGACCCTGGCTGTGGTATCTGACACGGACCACGGACTGCCGGATTTTCCAGAACAAGAATGTGCGTGA
CATCATCGGGGAAGTCCTCGCACCCTACGGATTTCCCTTTGAATTTCGTCTTGGCGCCCAGTATCGCGAG
TGGGAATATTGCGTCCAGTATCAGGAAAGCCATTTCGATTTCATCAGTCGTCTGATGGAGCAGGAGGGCA
TGTATTACTACTTCGAACATGCGCAGGGGCAGCAGACCTTGATCCTGGCCGATGATCTCAGCGCCCATGC
CAACCTGCCCGATTACGCGGTATTGCCCTATCTGGCCCCGGACCGGCTGGTGCTTCCGGATGAAGAAGGC
ATCGACAGCTGGCAGTCGGCCGTCGAGATCCGCTCCGGCGGATACGCGGTCGATGATTATGATTTCAAGA
AACCCAAGGCCAACCTCGGGCAGGTACGAAACCAGCAGCTGATCGACGGCCTTCACGGTCAATATCAGAA
ATACATCTGGCATGGCGGCTATATCGACGCCGATCAGGGGCTGCATTACGCACGCGTCAGGCTGGAAGAG
GAGCAGGCCGAGCATGCCCGGGTCCGCGCGCATACCAAGATCCGTGGCATCGCTCCCGGTTATCTGTTCA
ACCTCAAACATTGCCCGCGTCGCAGTGAAAACCGCGAATATCTGATTGTGGGCGTCAACTACCATTTCCA
GGAAGGCGGCTATGCCACTGGCAGCAGCGACAGTTTCTACGATTTCCATTTCGTGGTGCAGCCCTCTGAC
GTACCCTACCGCGCCCCCTGCATCACCCCGGTGCCGCGTGCGACCGGTCCGCAGACGGCCGTGGTGGTCG
GTCCGCCAGGACAGGAGATATGGACCGACCGCTATGCCCGGGTGAAGCTGCAGTTTCGCTGGGACCGCTA
TGGTCAGAGCAACGAGAACAGCTCTTGCTGGGTGCGGGTCTCCGATTCATGGGCGGGCACCAACTTCGGC
GGCATCTACATTCCCAGGGTCGGCCAGGAAGTGGTGGTGGACTTCCTCAACGGCGAGCTGGATCGTCCGC
TGATCACAGGCCGGATCTACAACGCGGATCAGATGCCGCCCTTCGGGCTGCCCGAATCAGCGACTCAGAG
CGGTTTCGTTACCCGGACGCCAGGCGGCTCCGCAGCCAATGCCAATATCCTTCGTTTCGAGGACAAGAAG
GGCGCCGAGCAGGTCAAGCTGCATGCCGAGCGCAACTATGACATTTCGGTCGAGCATGACGCCACCAAGT
CGGTAGCCAACAAGTATCTGCTGCAGGTGGGCTTTTTGCAGCTGCCGCCCGAATCGCAGCAATCCCCGCT
GCCGCGGATGAATCAGGTCCTGCCCGGCGCGGTCACCGCGGGCGGCCAGCAGCAGCAGCCTCACAACACC
GCGCCGGCGCCGGTCATTCCGATGCCGGCACAGTTCCAGCAACAGACGCCGGGTGATCTGGTGCAGGCCT
TTGCCCAGAACATCACCTCGGCGATCCAGTACGTGGCCAGCGCCGTCGGCAATGCCTCGGCCAAGGTCTA
CGGCGTCACCGTTGAAGGTCTGGCGGCCACGGTGATCTTCGGCGAAGACTTCTCGGTGGTGACCGGTGAC
ACCAGCGGTTTCGTCAACGGCAACCAGCTGACCGAGGTCAATGGCAACAACACGACCCTGATCGTGGGTG
ACAATTTCTCGACCATCATCGGCAATCACTTCAGCAATGTGGAGGGCAATTCCACCAGCAATGTGATCGG
CAACAATCTGAGTCATGTCGGGGGCAATTCCGAGTCCGTCGTCGATGCCAATACCTTGTCCGTGGTCGGC
GTGAACTCGACCAGCGAGATCGGCAATGATTCCACCAGCCAGATCGGCGCCAATGCCAGTACCTTCATTG
GCGCCGACAGTCTGACTGAAGTCGCCGGCAACAGCACCTCGCTGATCGCCGTGAACAGCCTGTCGGTCGT
GGGCGCTGCACAGGAAAGCATCGTGCCGCAGACCATGACGATCAACGGCAGCGCGGTGTCCGTGGTCGGC
AGTTCGGTTTCGACCACCGGGTCGGCGATATCCATGACCGGCAGCAGCGTGGCCAATACCGGCAGCAGCG
TTGCCAATACCGGCAGCTCGGTCAGCTCCACCGGCAGTTCGATCGCCAGCACCGGTTTCGCGCAGAGCAA
TACCGGCATGCAGCTCAGCGTGGTCGGCATGCAGATCACCATCGTGGGTCAGTCCATCACTTTGTGA