SecReT6
Protein ID: 383317040
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1795
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1910530..1911042 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDH8KZF8
KEGG IDfau:Fraau_1795
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.40E-32, Aligned region: 18..163
Protein Sequence: 170 a.a.     [Download]
>gi|383317040|ref|YP_005377882.1| type VI secretion lipoprotein [Frateuria aurantia DSM 6220]
MASRLRMHWLFLLAMAWIAAGCASTQKSMLIPYDVYLDVEAEVNPNLQGHPSPILVGLYELGSDSQFLNL
DFPAVQDRARVSLGDDLISVDQIILRPGEQRIIRRAGNAAARHLGVVAGYRELGRQPWRLSIPLPGTKST
NLYKFWQISPRRMSIRIEVGRQGLAIRQRH
 
Nucleotide Sequence: 513 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1910530-1911042 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGGCCAGTCGCTTGCGCATGCACTGGCTTTTCCTGCTGGCGATGGCATGGATCGCCGCAGGATGTGCCT
CGACCCAGAAGTCGATGCTGATTCCCTACGATGTATACCTGGATGTGGAGGCGGAAGTGAATCCCAACCT
GCAGGGCCATCCCTCGCCGATCCTGGTCGGCCTGTATGAACTGGGCTCGGACAGCCAGTTTCTCAATCTG
GACTTCCCGGCCGTGCAGGACCGGGCGCGCGTCAGTCTGGGGGACGATTTGATCTCGGTGGATCAGATCA
TCCTGCGTCCGGGTGAGCAGCGGATCATCCGCCGTGCAGGCAATGCAGCGGCACGTCATCTGGGGGTGGT
TGCCGGCTACCGCGAGCTGGGTCGGCAGCCATGGCGGCTGTCGATTCCGTTGCCGGGGACCAAGAGTACC
AACCTTTACAAGTTCTGGCAGATATCGCCACGTCGCATGTCGATACGGATTGAAGTCGGCCGGCAGGGCC
TGGCGATCAGGCAGAGGCATTGA