SecReT6
Protein ID: 383317041
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1796
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1911043..1912419 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDH8KZF9
KEGG IDfau:Fraau_1796
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-149, Aligned region: 33..457
Protein Sequence: 458 a.a.     [Download]
>gi|383317041|ref|YP_005377883.1| type VI secretion protein [Frateuria aurantia DSM 6220]
MDTRSNPQLPPKDGGAWRSKVVWSEGMYLRPQHFQQMERYLEHLVQLRSRALGSHYWGFLRYELDQEALA
LGKLALSMAQGVMPDGTPFHFASREEAPEALAVPAGVTAREVVLALPLRRPGGEDCIFEERRDSLARYGV
LTREIADVNSVALGPASLQLGRPRFRLALVDELGHDWQAVGLARILEARGDGRLLLDPAYVPPTLAAAEN
EVLRSAMHEVHGLLEQRGRLLSQRLSQPGRGGVAEIADFLLLGMINRAQADTWHGLQLEQLHPETLFLRW
LRIASELATYTSRERRPQVWPVYRHDDLQACFEPLMAELRRALSTMLEQNAIAIELEERAPRVWVARIPS
LELLRNAGFVLAVHADAPAEVVRNRYPAQVKIGPVEQLHDLVHLHLPGIGIRNLPVAPRQIPYHAGHHYF
ELDTQSELWGQLSQSGGLALHFAGDLPGLKMACWAIRG
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1911043-1912419 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGGATACCCGCTCGAATCCGCAGCTCCCGCCCAAGGATGGCGGAGCCTGGCGCAGCAAGGTGGTCTGGT
CCGAAGGCATGTACCTGCGGCCCCAGCACTTTCAGCAGATGGAACGCTATCTGGAGCATCTGGTCCAGTT
GCGAAGTCGTGCGCTTGGCAGTCATTACTGGGGTTTTCTGCGTTATGAGCTGGATCAGGAAGCGCTGGCC
CTCGGCAAGCTGGCGCTGTCCATGGCGCAGGGCGTGATGCCGGACGGCACCCCCTTCCATTTCGCCAGTC
GCGAGGAGGCGCCGGAGGCACTGGCGGTGCCGGCAGGCGTCACGGCCCGCGAGGTGGTACTGGCGCTTCC
CTTGCGGCGACCCGGGGGGGAAGACTGCATTTTCGAGGAGCGTCGGGATTCCCTGGCCCGCTATGGGGTG
CTGACGCGTGAAATTGCCGATGTGAATTCGGTGGCACTGGGACCGGCCAGCCTGCAGCTGGGCCGGCCAC
GTTTCCGGCTGGCACTTGTCGATGAGCTGGGCCACGACTGGCAAGCAGTGGGCCTGGCCCGGATCCTTGA
AGCCCGTGGCGATGGCCGTCTGCTGCTGGACCCGGCCTATGTGCCACCGACCCTGGCCGCCGCTGAAAAC
GAGGTGCTGCGCAGTGCCATGCATGAAGTTCATGGGCTGCTGGAACAGCGCGGACGGCTGCTGTCGCAAC
GGCTGTCACAGCCTGGCCGTGGCGGCGTCGCCGAAATCGCCGATTTCCTGCTGCTGGGAATGATCAATCG
GGCCCAGGCCGATACCTGGCATGGTCTGCAGCTGGAGCAGCTGCATCCGGAGACGCTGTTTCTGCGTTGG
CTGCGGATCGCCTCGGAGCTGGCAACCTATACCTCGCGCGAACGACGCCCACAGGTATGGCCGGTGTATC
GGCACGATGATCTGCAGGCCTGCTTCGAACCGCTGATGGCGGAGTTGAGGCGGGCGCTGTCCACCATGCT
GGAGCAGAACGCGATTGCCATCGAGCTGGAGGAAAGGGCACCACGGGTCTGGGTGGCGCGGATTCCCAGT
CTGGAACTGTTGCGCAATGCCGGGTTCGTGCTGGCCGTGCATGCCGATGCGCCGGCCGAGGTGGTTCGCA
ACCGTTACCCGGCTCAGGTCAAGATCGGGCCGGTGGAACAGCTGCACGACCTGGTTCACCTGCATCTGCC
GGGGATCGGCATCCGCAACCTGCCCGTCGCGCCACGACAGATTCCATATCATGCCGGTCATCATTATTTC
GAACTCGATACCCAAAGTGAATTGTGGGGACAGTTGTCGCAATCCGGCGGGCTGGCCCTGCATTTCGCGG
GTGACCTGCCGGGGCTGAAAATGGCCTGCTGGGCCATCCGCGGCTGA