SecReT6
Protein ID: 383317042
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1797
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1912478..1913758 [+]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDH8KZG0
KEGG IDfau:Fraau_1797
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-61, Aligned region: 39..243
OmpA [PF00691], Evalue: 5.50E-17, Aligned region: 308..407
Protein Sequence: 426 a.a.     [Download]
>gi|383317042|ref|YP_005377884.1| type VI secretion system OmpA/MotB family protein [Frateuria aurantia DSM 6220]
MNHRGGLSLASSGQEPAPGLTYPGPGIPGDPAFGRSSHNPLLLAARPLLNLMVQIRTGKQAINPVLLRER
LISAIRRFQDQAQALSTPVETIVGARYCLCTALDESAALTSWGGDGIWSAHSLLVIFHNETWGGEKFFQL
LARLIQDPGRHWPLIELQFHCLALGFEGRYRIIDNGQAQLEGLKLRLRKLLAAGAGGQGDALAGHWLDPQ
GRASATLRRWVPLWSWLVLALILTAGVYVGLLLLLNARLDAGYVAVNSIHLPELDILAAPAQRDLHLKEL
LADDIRGGALSVEDAADHHVITLRGDGLFDSGRADLRPAYRAVLARVAAALDRVPGRIVLVGHTDNQPIH
TASYPSNQTLSLARARSVADFLHDTALGAHRDIQVQGQGDTHPLTSNDTASGRALNRRVEMVLFPGAAAS
PSPWTR
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1912478-1913758 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGAACCATCGAGGCGGTCTATCCCTGGCCAGTTCCGGACAGGAGCCGGCACCGGGTCTGACCTATCCCG
GACCGGGCATTCCCGGCGATCCGGCTTTCGGCCGCAGCAGTCACAATCCGCTGCTGCTGGCGGCGCGTCC
GCTTTTGAATCTGATGGTTCAGATCCGTACCGGGAAGCAGGCCATCAACCCGGTATTGCTGCGCGAACGA
CTGATCAGCGCGATACGCCGCTTCCAGGACCAGGCCCAGGCGCTTTCGACGCCGGTGGAGACCATCGTCG
GAGCCCGCTACTGCCTGTGCACCGCGCTGGACGAGTCTGCCGCGCTGACCAGCTGGGGAGGGGACGGTAT
CTGGTCGGCTCACAGCCTGTTGGTCATTTTCCACAACGAGACGTGGGGGGGCGAAAAATTCTTCCAGTTG
CTGGCGCGACTGATCCAGGATCCGGGTCGCCATTGGCCTCTGATCGAACTGCAGTTCCATTGCCTGGCAC
TGGGCTTCGAGGGTCGCTATCGCATCATCGACAACGGCCAGGCCCAGCTGGAAGGGCTGAAGCTGAGATT
GCGCAAGTTGCTGGCTGCCGGTGCGGGGGGGCAGGGGGATGCCTTGGCCGGCCATTGGCTGGATCCGCAA
GGGCGGGCTTCAGCCACGCTGCGGCGCTGGGTGCCCCTGTGGAGCTGGTTGGTGCTGGCCCTGATACTGA
CGGCCGGGGTCTATGTCGGACTGCTGTTGCTGTTGAATGCCAGACTGGATGCCGGCTATGTCGCGGTCAA
TTCCATCCACCTGCCTGAACTGGATATTCTGGCGGCCCCGGCACAGCGCGACCTGCATCTGAAAGAACTG
CTGGCTGACGATATCCGCGGTGGCGCGCTCAGTGTGGAGGATGCCGCAGATCATCATGTCATCACCTTGC
GTGGCGATGGCCTGTTCGACTCCGGCCGGGCCGATCTCAGGCCGGCTTATCGCGCCGTGCTGGCCCGTGT
CGCGGCGGCCCTGGATCGCGTGCCGGGACGCATTGTGCTGGTCGGTCATACCGACAATCAGCCCATCCAT
ACAGCCAGTTATCCTTCCAACCAGACCTTGTCCCTGGCCCGGGCCAGAAGCGTGGCGGATTTCCTGCATG
ACACCGCCCTGGGCGCTCATCGCGACATCCAGGTGCAAGGGCAAGGCGACACGCATCCGCTGACATCCAA
TGACACCGCCTCAGGCAGGGCACTGAATCGAAGGGTGGAAATGGTGCTGTTTCCCGGAGCGGCGGCTTCT
CCATCTCCCTGGACCCGGTAG