SecReT6
Protein ID: 383317044
SecReT6 ID559
T6SS typei3
Gene symbol-
Locus tagFraau_1799
StrainFrateuria aurantia DSM 6220
Repliconchromosome [GenBank: NC_017033] [Browse all T6SS(s) in this replicon]
Location [Strand]1917402..1918274 [+]
Producthypothetical protein
NoteFha
UniProt IDH8KZG2
KEGG IDfau:Fraau_1799
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00036, Aligned region: 28..93
Protein Sequence: 290 a.a.     [Download]
>gi|383317044|ref|YP_005377886.1| hypothetical protein [Frateuria aurantia DSM 6220]
MKLTISSHLGQPSDGSQSAVFPPRGGSLGHRSDNTLVLADRHGTIAGRHATFYQGTDGWRIAPEPGATVA
VNGHSVAHGHEWPVAPGDVLEIGAYVLTPGEEHSPWSGLTSGPEVIAPPSTPARPHPLQSSPERTSPSAA
DPLAGVKGRTGLDELQDTPLDPLALFAAQDTAAAASLLDDSLLSGFEQGLSPRQSPTGFNPSLSDSVPEQ
SGHLRVQIQWPDPESPAGTVAEPVVSRTDGEAGQSTEASAEVLLQALRDGLGQRQRMEWPDPDFMRLLGA
TLRALRTQLR
 
Nucleotide Sequence: 873 bp     [Download]
>gi|383315351|ref|NC_017033.1|:1917402-1918274 Frateuria aurantia DSM 6220 chromosome, complete genome
ATGAAACTGACCATTAGTTCGCATCTGGGGCAACCCTCCGACGGAAGCCAGTCCGCGGTATTCCCGCCGC
GAGGAGGCAGTCTGGGGCACCGCAGCGACAACACCCTGGTACTGGCTGATCGCCACGGCACCATCGCCGG
CCGTCATGCCACCTTCTATCAAGGCACTGATGGCTGGCGGATCGCGCCGGAGCCGGGCGCCACCGTGGCG
GTCAATGGTCATTCAGTGGCTCATGGTCACGAGTGGCCCGTGGCGCCTGGTGACGTATTGGAGATCGGCG
CCTATGTATTGACGCCGGGCGAGGAGCACTCGCCCTGGAGCGGGTTGACCTCCGGCCCGGAGGTGATCGC
ACCGCCCTCCACGCCGGCACGGCCCCATCCGCTGCAATCGAGTCCGGAGCGCACATCACCATCCGCGGCC
GATCCGTTGGCCGGCGTCAAAGGCCGGACCGGTCTGGACGAGCTGCAGGATACCCCGCTGGATCCCCTGG
CCCTGTTCGCGGCTCAGGACACCGCTGCGGCCGCCTCCTTGCTGGACGACTCTTTGCTGAGCGGTTTTGA
ACAAGGCCTGTCGCCACGTCAGTCGCCGACAGGTTTCAACCCCAGCCTGTCGGACAGCGTGCCGGAGCAG
TCCGGTCATCTGCGCGTGCAGATTCAATGGCCGGATCCGGAGTCTCCTGCCGGGACCGTTGCGGAGCCGG
TGGTGAGCAGAACCGACGGCGAGGCGGGTCAGAGCACGGAAGCCAGCGCCGAGGTCTTGCTGCAGGCTTT
GCGGGATGGCCTGGGTCAGCGTCAGCGCATGGAGTGGCCCGATCCCGATTTCATGCGCTTGCTGGGGGCG
ACCCTGCGTGCCTTGCGGACCCAGCTTCGCTGA