SecReT6
Protein ID: 383456124
SecReT6 ID558
T6SS typei1
Gene symbol-
Locus tagCOCOR_04141
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5159000..5159644 [+]
Producthypothetical protein
NoteTssB
UniProt IDH8MXD4
KEGG IDccx:COCOR_04141
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.90E-43, Aligned region: 5..160
Protein Sequence: 214 a.a.     [Download]
>gi|383456124|ref|YP_005370113.1| hypothetical protein COCOR_04141 [Corallococcus coralloides DSM 2259]
MAIQDQLPKSRITLTYRTTINGEQETVNLPLRLLVMGDFSLGSSEDRKTDLETRKLRSVDGRNLDELMKD
MKMSTNFQVANRINPDVEEELNVTLPIDRMKSFHPDEIVKHVPKLKALLLLKTLLVEMQSNIDNRKDLRR
ELYELFSKPEALKELLNELKGYETMRLPAGETAAKTDAPAAGAAAAGKPAGGAAAATAAVAATVAAGAKP
PAAS
 
Nucleotide Sequence: 645 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5159000-5159644 Corallococcus coralloides DSM 2259 chromosome, complete genome
GTGGCCATTCAGGACCAGCTTCCCAAATCCCGCATCACCCTCACGTACCGCACCACCATCAACGGCGAGC
AGGAGACGGTGAACCTGCCGTTGCGCCTCCTGGTCATGGGCGACTTCTCCCTGGGCTCCTCCGAGGACCG
CAAGACGGACCTGGAGACGCGCAAGCTGCGGTCCGTGGACGGCCGCAACCTGGACGAGTTGATGAAGGAC
ATGAAGATGTCCACCAACTTCCAGGTCGCCAATCGCATCAACCCGGACGTGGAGGAGGAGCTGAACGTCA
CGCTCCCCATCGACCGGATGAAGTCCTTCCACCCGGATGAGATCGTCAAGCACGTGCCGAAGCTCAAGGC
GCTGCTGCTGCTGAAGACGCTCCTCGTGGAGATGCAGTCGAACATCGACAACCGCAAGGATCTGCGCCGC
GAGCTCTACGAGCTGTTCTCCAAGCCGGAGGCGCTCAAGGAGCTGCTCAACGAGCTGAAGGGCTACGAGA
CCATGCGCCTGCCCGCCGGTGAGACCGCGGCGAAGACGGACGCGCCCGCCGCCGGTGCCGCCGCCGCTGG
CAAGCCCGCCGGGGGTGCCGCCGCCGCCACGGCCGCGGTCGCCGCCACCGTCGCCGCGGGTGCCAAGCCC
CCGGCCGCTTCCTGA