SecReT6
Protein ID: 383456125
SecReT6 ID558
T6SS typei1
Gene symbol-
Locus tagCOCOR_04142
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5159686..5161173 [+]
Producthypothetical protein
NoteTssC
UniProt IDH8MXD5
KEGG IDccx:COCOR_04142
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.90E-154, Aligned region: 75..494
Protein Sequence: 495 a.a.     [Download]
>gi|383456125|ref|YP_005370114.1| hypothetical protein COCOR_04142 [Corallococcus coralloides DSM 2259]
MAETTYLKRLFTSVRLDPPQESAPMITTNFAPAGDEQQVTLESRFLSSVAALLQNVAPVEGPDNTARFDK
GQVLDVISRIDRMIDAQMNEILHNETFQKLESTWRGLEDLVDHTNFKANIAIDILDVAKDELAEDFENNS
SNIFAGALFDKVYIQEYDQYGGRPFGAIVGLYDFSSTPADLTWLQRMAKVSNAAHAPFISAVNHKFFGCE
TIEEMEAIKNLEGVLAHPRFGRWNAFRDTEEAAYVGLTFPRYVLRLPWHPDKNPCDVLNFTETARGDSDK
YLWGNSAILLARNMVKAFEISGWCQSIRGPKGGGLISGLPVDTFSLRGQEEIKAPVEIAIPDYREYEFAR
SGFIPLVYRKGSSDATFFSTQSAKVAKTFKDPKDSENSQLVTNLAYTFSITRLAHYVKCIMRDNIGNTAD
APYIQRQLDSWLSNYVTTVANPDDLTVRRFPFKASSVTVFPRPGEIGWYDCKLAVLPHIQFEGLNVELML
ESRLG
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5159686-5161173 Corallococcus coralloides DSM 2259 chromosome, complete genome
ATGGCTGAGACCACCTACCTGAAGCGCCTGTTCACCAGCGTCCGGCTCGATCCGCCCCAGGAATCGGCGC
CGATGATCACCACCAACTTCGCGCCCGCCGGCGACGAGCAGCAGGTCACCCTGGAGAGCCGTTTCCTCTC
CAGCGTCGCCGCGCTCCTGCAGAACGTGGCCCCCGTGGAGGGCCCGGACAACACCGCCCGCTTCGACAAG
GGCCAGGTGCTGGACGTCATCAGCCGCATCGATCGCATGATCGACGCGCAGATGAACGAGATCCTCCACA
ACGAGACCTTCCAGAAGCTGGAGTCCACGTGGCGCGGCCTGGAGGACCTGGTCGACCACACCAACTTCAA
GGCCAACATCGCCATCGACATCCTGGACGTCGCCAAGGACGAGCTGGCGGAGGACTTCGAGAACAACTCC
AGCAACATCTTCGCCGGAGCGCTGTTCGACAAGGTCTACATCCAGGAGTACGACCAGTACGGCGGCCGTC
CCTTCGGCGCCATCGTGGGCCTGTACGACTTCTCCTCCACGCCCGCGGACCTGACCTGGCTGCAGCGCAT
GGCCAAGGTCTCCAACGCCGCGCACGCGCCGTTCATCTCCGCCGTGAACCACAAGTTCTTCGGCTGCGAG
ACCATCGAGGAGATGGAGGCCATCAAGAACCTGGAGGGCGTGCTCGCCCACCCGCGGTTCGGCCGCTGGA
ACGCGTTCCGCGACACGGAGGAGGCCGCCTACGTGGGCCTGACCTTCCCGCGCTACGTGCTGCGCCTGCC
CTGGCATCCGGACAAGAACCCCTGCGACGTCCTCAACTTCACCGAGACGGCGCGCGGCGACTCCGACAAG
TACCTCTGGGGCAACTCCGCCATCCTGCTCGCGCGCAACATGGTGAAGGCGTTCGAGATCTCCGGCTGGT
GCCAGTCCATCCGCGGCCCCAAGGGCGGTGGCCTCATCTCCGGCCTGCCCGTGGACACCTTCTCCCTGCG
CGGCCAGGAGGAGATCAAGGCCCCGGTGGAGATCGCCATCCCGGACTACCGCGAGTACGAGTTCGCGCGT
AGCGGCTTCATCCCGCTCGTGTACCGCAAGGGTTCCAGCGACGCGACGTTCTTCAGCACCCAGTCCGCCA
AGGTCGCCAAGACGTTCAAGGACCCCAAGGACTCGGAGAACTCGCAGCTCGTCACCAACCTGGCCTACAC
GTTCTCCATCACGCGGCTGGCGCACTACGTGAAGTGCATCATGCGCGACAACATCGGCAACACGGCGGAC
GCGCCCTACATCCAGCGCCAGCTGGACTCGTGGCTGTCCAACTACGTCACGACCGTGGCCAACCCGGACG
ACCTCACGGTGCGCCGCTTCCCGTTCAAGGCGAGCAGCGTGACGGTGTTCCCGCGCCCCGGTGAGATCGG
CTGGTATGACTGCAAGCTGGCCGTGCTCCCGCACATCCAGTTCGAAGGCCTCAACGTGGAGCTGATGCTC
GAGTCGCGGCTCGGTTAA