SecReT6
Protein ID: 383456127
SecReT6 ID558
T6SS typei1
Gene symbol-
Locus tagCOCOR_04144
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5161900..5163150 [+]
Producthypothetical protein
NoteTssK
UniProt IDH8MXD7
KEGG IDccx:COCOR_04144
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-48, Aligned region: 21..106
DUF876 [PF05936], Evalue: 4.60E-48, Aligned region: 124..413
Protein Sequence: 416 a.a.     [Download]
>gi|383456127|ref|YP_005370116.1| hypothetical protein COCOR_04144 [Corallococcus coralloides DSM 2259]
MQRYKLARVRWHVGQTLLPEHFVAQEDALDAEIRLHSTLSGLPSYGVANLAWNESLLQSGSLSISALTVV
TKSGDLLDVPGNSVISPLSLEAVGKTEFIVYLHVLKETVSAEGIRLYADDPPVLQRVLHKLQLSTEPVLD
GTIGSLGLAAVSQDEDGAWHTSPDWVPPLLLVGPNPFLEKLLSTLDDLLDQVRQQLLTNISDTYLRTDRL
TNARRALFEVQRLIALRRDMFRQVYVHPYHLFDALRRLYFEACCYLEMLPDEQMPVYQHEGLNEALGGWI
RLLTRSFQPEATRSTHKAFQAKEGQFQMTPLPPEIRSASEAYLLVQRTQPGERTPLDGVKLASPSRLPLV
RRQALKGVPFKHVPYPSFPHALGPEIDWYLLSNGEEWQHALREDGLAFYVTPALRGAQTSLFWRRS
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5161900-5163150 Corallococcus coralloides DSM 2259 chromosome, complete genome
ATGCAGCGGTACAAGCTCGCACGGGTCCGCTGGCACGTCGGCCAGACGCTTCTTCCGGAGCATTTCGTCG
CGCAGGAGGACGCGCTGGACGCGGAGATCCGCCTCCACTCCACGCTGTCCGGCCTGCCGTCCTACGGCGT
CGCGAACCTGGCCTGGAACGAGTCGCTCCTGCAGAGCGGCAGCCTGTCCATCTCCGCGCTCACCGTCGTC
ACCAAGTCCGGGGACCTGCTGGACGTCCCGGGCAACTCCGTCATCTCGCCCCTGTCGCTGGAAGCCGTGG
GCAAGACGGAGTTCATCGTCTACCTGCACGTGCTCAAGGAGACCGTCAGCGCGGAGGGCATCCGCCTGTA
CGCGGATGATCCGCCGGTGCTCCAGCGCGTGCTGCACAAGCTGCAGCTGTCCACGGAGCCGGTGCTGGAC
GGGACCATTGGCTCCCTGGGGCTGGCCGCCGTGTCGCAGGACGAGGACGGCGCGTGGCACACGTCTCCGG
ACTGGGTGCCGCCGCTCTTGCTCGTGGGGCCCAACCCCTTCCTGGAGAAGCTGCTCTCCACGCTGGACGA
CCTGCTGGATCAGGTGCGCCAGCAGTTGCTCACCAACATCTCGGACACGTACCTGCGGACGGACCGGCTC
ACCAACGCGCGCCGGGCGCTCTTCGAAGTGCAGCGGCTCATCGCGCTGCGCCGGGACATGTTCCGTCAGG
TGTACGTGCACCCGTACCACCTGTTCGACGCGCTCCGCCGGCTGTACTTCGAGGCCTGCTGCTACCTGGA
GATGCTCCCGGACGAGCAGATGCCGGTGTACCAGCACGAGGGGCTCAACGAGGCCCTGGGCGGGTGGATC
CGCCTGCTCACGCGCAGCTTCCAGCCGGAGGCCACGCGCTCCACGCACAAGGCCTTCCAGGCGAAGGAAG
GGCAGTTCCAGATGACGCCGCTGCCGCCGGAGATCCGCTCCGCCAGCGAGGCCTACCTGCTGGTGCAGCG
CACCCAGCCCGGGGAGCGCACGCCGCTGGACGGCGTGAAGCTGGCGAGCCCCTCGCGGCTGCCGCTGGTG
CGCCGCCAGGCCCTGAAGGGCGTGCCCTTCAAGCACGTGCCGTATCCGTCCTTCCCTCACGCGCTGGGGC
CGGAGATTGACTGGTACCTCCTGAGCAACGGCGAGGAGTGGCAGCACGCGCTGCGCGAGGACGGCCTGGC
CTTCTACGTGACTCCCGCGCTCCGGGGCGCCCAGACCTCGCTGTTCTGGCGGAGGAGCTAG