SecReT6
Protein ID: 383456128
SecReT6 ID558
T6SS typei1
Gene symbol-
Locus tagCOCOR_04145
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5163156..5163545 [+]
ProductGpw/Gp25 family protein
NoteTssE
UniProt IDH8MXD8
KEGG IDccx:COCOR_04145
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-12, Aligned region: 19..108
Protein Sequence: 129 a.a.     [Download]
>gi|383456128|ref|YP_005370117.1| Gpw/Gp25 family protein [Corallococcus coralloides DSM 2259]
MARAPFLDKFATRRERTNTRDSLEHVMRNIEAVLNTKKGYGFFMHDFGLGGYTEKLGTRELVEALTAEIQ
QEVTQHEPRLVEPEVKLRGRDSSLWLYFDCKGTFDGQPCHLSLMFHSTTGRVRVQAEDT
 
Nucleotide Sequence: 390 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5163156-5163545 Corallococcus coralloides DSM 2259 chromosome, complete genome
ATGGCGCGCGCACCCTTCCTGGACAAGTTCGCGACCCGCAGGGAGCGCACCAACACGCGCGACAGCCTGG
AGCACGTGATGCGCAACATCGAAGCCGTGCTCAACACGAAGAAGGGCTACGGCTTCTTCATGCACGACTT
CGGGCTGGGCGGGTACACGGAGAAGCTGGGCACGCGCGAGCTGGTGGAGGCGCTCACCGCCGAAATCCAG
CAGGAAGTCACCCAGCACGAGCCCCGGCTGGTGGAGCCGGAAGTGAAGCTGCGCGGCCGTGACAGCTCGC
TGTGGCTGTACTTCGACTGCAAGGGCACGTTCGACGGACAGCCCTGCCACCTGTCGCTGATGTTCCACTC
CACCACCGGCCGGGTGCGCGTGCAGGCGGAGGACACCTGA