SecReT6
Protein ID: 383456131
SecReT6 ID558
T6SS typei1
Gene symbol-
Locus tagCOCOR_04148
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5165932..5167578 [+]
Producthypothetical protein
NoteTssF
UniProt IDH8MXE1
KEGG IDccx:COCOR_04148
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-35, Aligned region: 14..336
DUF879 [PF05947], Evalue: 3.00E-35, Aligned region: 408..441
Protein Sequence: 548 a.a.     [Download]
>gi|383456131|ref|YP_005370120.1| hypothetical protein COCOR_04148 [Corallococcus coralloides DSM 2259]
MKDFSEKIYLDFLSELDGLERFRQRFQERHPAAPLDREDPDVRRLIEAMAFFSVQTRHATLHNLRSTWRR
LFAGFFDFLLEPVPAAAMAQAVPTEKMVEPVLLTRGTELRLTPAEGVSGSFRLQRDLRVMPIFLKGTDVV
PQVRSGHRLILRFESRFARKDPIDVLSLHVRHLDDYRSSLAVFHALRKHVKQVSVVYDEEADEHSVGSPC
EVSFNRDPPAPDDSGLYAHPFQRLRAFFQFPEQQLFVHVKVPPPRGSSWMRFCICLDLDKDWNIGRSLHP
DFFQLFTVPVVNLKAEPAQVVVADGTRAEHPIISMSAGREFTLHSVTGVFEMTKAGLAPLRPAFLPGKGP
SYEVDETFDEKLASRQSLIVRMPEAFTAPRKIVLEALWHQPQFSAQAAGRVEVSVPGRHIEGLKWQTVGS
LQPHRDSVLRDDVEALTQFLAWKAKPTLGRDEVVALLGHLGTPAESPFRRVLPWLKELKFSVVPDSALKG
SGIRHAYEAVMEPFDQSFEPVVICFLEQLRDLLDAWNNEATVDLKASVAGLGPLQLPT
 
Nucleotide Sequence: 1647 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5165932-5167578 Corallococcus coralloides DSM 2259 chromosome, complete genome
GTGAAGGACTTCTCCGAGAAGATCTACCTGGATTTCCTGTCGGAACTGGACGGGCTGGAGCGCTTCCGTC
AGCGCTTCCAGGAGCGGCACCCGGCGGCCCCGTTGGATCGCGAGGACCCGGACGTGCGCCGCCTCATCGA
GGCGATGGCGTTCTTCTCCGTGCAGACGCGGCACGCCACGCTGCACAACCTGCGCTCCACCTGGCGCCGG
CTGTTCGCGGGCTTCTTCGACTTCCTCCTGGAGCCTGTGCCCGCCGCCGCCATGGCGCAGGCCGTGCCCA
CGGAGAAGATGGTGGAGCCGGTGCTCCTCACCCGGGGCACGGAGCTGCGCCTGACGCCCGCGGAAGGGGT
GTCCGGCTCCTTCCGGCTCCAGCGCGACCTGCGCGTGATGCCCATCTTCCTCAAGGGCACGGACGTGGTG
CCGCAGGTGAGAAGCGGCCACCGGCTCATCCTCCGCTTCGAGTCCCGCTTCGCGCGCAAGGACCCCATCG
ACGTGCTCAGCCTGCACGTGCGGCACCTGGACGACTACCGCTCGTCTCTGGCGGTGTTCCATGCGCTGCG
CAAGCACGTGAAGCAGGTGAGCGTCGTCTACGACGAAGAGGCGGATGAGCACTCCGTGGGCAGCCCCTGC
GAGGTGTCCTTCAACCGCGACCCGCCCGCGCCGGACGACAGCGGCCTCTACGCGCACCCGTTCCAGCGCC
TGCGCGCGTTCTTCCAGTTCCCGGAGCAGCAGCTCTTCGTGCACGTGAAGGTGCCGCCGCCGCGTGGCAG
CTCCTGGATGCGGTTCTGCATCTGCCTGGACCTGGACAAGGACTGGAACATCGGCCGCTCGCTGCACCCG
GACTTCTTCCAGCTCTTCACCGTGCCGGTGGTGAATCTCAAGGCGGAGCCCGCGCAGGTGGTGGTGGCGG
ACGGAACGCGCGCGGAGCACCCCATCATCAGCATGAGCGCGGGGCGCGAGTTCACCCTGCACTCGGTGAC
GGGCGTCTTCGAGATGACCAAGGCGGGCCTGGCCCCGCTGCGGCCCGCCTTCCTGCCCGGCAAGGGCCCC
AGCTACGAGGTGGACGAGACCTTCGACGAGAAGCTCGCCTCCCGGCAGAGCCTCATCGTGCGCATGCCGG
AGGCCTTCACCGCGCCGCGAAAGATTGTGTTGGAGGCGCTGTGGCACCAGCCGCAGTTCTCCGCGCAGGC
GGCGGGCAGGGTGGAGGTGTCCGTGCCGGGCCGCCACATCGAGGGCCTGAAATGGCAGACAGTGGGCAGC
CTCCAGCCCCACCGCGACAGCGTGCTACGGGATGATGTCGAGGCGTTGACCCAATTCCTCGCGTGGAAGG
CAAAGCCCACGCTGGGCCGCGACGAGGTGGTCGCCCTGTTGGGTCACCTGGGGACCCCCGCGGAGAGCCC
GTTCCGCCGCGTCCTTCCATGGCTCAAGGAGTTGAAGTTCAGTGTGGTGCCCGACAGCGCGCTCAAGGGT
TCGGGGATCCGCCACGCATACGAAGCCGTGATGGAGCCCTTCGACCAGAGCTTCGAGCCTGTCGTCATCT
GCTTTCTTGAGCAGTTGAGGGACCTGCTTGATGCTTGGAACAACGAGGCGACTGTTGATCTCAAGGCCTC
GGTGGCGGGTCTGGGGCCGCTACAGCTTCCAACATAG