SecReT6
Protein ID: 383456132
SecReT6 ID558
T6SS typei1
Gene symbol-
Locus tagCOCOR_04149
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5167591..5168232 [+]
Producthypothetical protein
NoteTssL
UniProt IDH8MXE2
KEGG IDccx:COCOR_04149
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.80E-16, Aligned region: 42..210
Protein Sequence: 213 a.a.     [Download]
>gi|383456132|ref|YP_005370121.1| hypothetical protein COCOR_04149 [Corallococcus coralloides DSM 2259]
MKLEHWNALLATQRRVRQLLDRALPAEPAPGARRPQGRVGQEALGHLEQALMVELERLRAAFGADLRPDE
VEDLIRPFVFFLDEWVLRRLSDAEQHLWPLLQQNLFQVDAGGDLFYEFVEEKLRRNDTPSIVFEMIRFCL
AAGFTGRLVGQPERIRELKDRISQRIPQPAAMAPPAPVVPATVPTVYDFPVHYYAVTAAIVLGLPVFLWW
VSN
 
Nucleotide Sequence: 642 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5167591-5168232 Corallococcus coralloides DSM 2259 chromosome, complete genome
ATGAAACTGGAGCATTGGAACGCACTCCTGGCCACGCAGCGTCGCGTGCGCCAGCTCCTCGACCGGGCCC
TGCCCGCCGAGCCCGCCCCGGGTGCGCGCCGGCCGCAGGGCAGGGTGGGGCAGGAGGCGCTGGGCCACCT
GGAGCAGGCGCTGATGGTGGAACTGGAGCGCCTGCGCGCCGCGTTCGGCGCGGACTTGCGCCCGGACGAA
GTGGAGGATCTGATCCGCCCCTTCGTCTTCTTCCTGGATGAGTGGGTGCTGCGGCGGTTGTCGGACGCGG
AGCAACATCTCTGGCCGCTCCTGCAGCAGAACCTGTTTCAGGTTGATGCAGGCGGAGACCTCTTCTACGA
GTTCGTGGAAGAGAAGTTGCGTCGCAACGATACGCCCTCCATCGTCTTCGAGATGATCCGCTTCTGCCTG
GCTGCGGGCTTCACGGGCCGCCTCGTGGGGCAGCCGGAGCGCATCCGCGAACTCAAGGACCGCATCTCGC
AGCGCATCCCGCAGCCGGCCGCCATGGCGCCGCCCGCGCCGGTGGTGCCCGCGACGGTGCCCACCGTCTA
TGACTTCCCGGTGCACTACTACGCCGTGACGGCGGCCATCGTGCTGGGGCTGCCCGTCTTCCTGTGGTGG
GTCTCCAATTGA