SecReT6
Protein ID: 383456146
SecReT6 ID558
T6SS typei1
Gene symboloprF1
Locus tagCOCOR_04163
StrainCorallococcus coralloides DSM 2259
Repliconchromosome [GenBank: NC_017030] [Browse all T6SS(s) in this replicon]
Location [Strand]5186293..5187615 [+]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDH8MXF6, H8MXF6
KEGG IDccx:COCOR_04163
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.80E-12, Aligned region: 352..431
Protein Sequence: 440 a.a.     [Download]
>gi|383456146|ref|YP_005370135.1| OmpA domain-containing protein [Corallococcus coralloides DSM 2259]
MRLVDSSFLKFGSLVLAGLLAPGAFAAEPTREEQVRAELERQLRDMVPESPSEVQVLFAGFKPEDGYRLV
ETDFLLDGEPLAVPGLDELNAPGVHRLANLKVEPGEHTLVSRVTYTNGSWSLFSETNGFLWKITASVGFQ
TQRGLRVVVKASPSVVPNAPDPRLKLKLTHAVTAEMIQPLKDEPAVVTAPPVKPAPVDAGAPVKVAQPTP
PPDAGVKPTTTVVSVTPPVERPPVAASRLRLQVTSKKPTSATAFVRGPGEPLKLTVPGKKPQDVPLSAGA
YTVDLIADGFLAQTRQVVLAAGADTSLAFALVPAPKAAKAAKVQEGRIELPQPLSFDEKKPVPAKASLAG
LDLAVDLLVRDPKARLRIEGHTDSKEVPEPARQSLSDARARAVADMLIRAGVAPSRVEAVGLGDRSPKAP
NLIPRGRELNRRVELVLLRP
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|383452024|ref|NC_017030.1|:5186293-5187615 Corallococcus coralloides DSM 2259 chromosome, complete genome
ATGCGCCTCGTGGATTCCTCCTTCCTCAAATTCGGGTCCCTGGTCCTCGCCGGACTCCTCGCCCCGGGCG
CGTTCGCGGCGGAGCCGACGCGCGAGGAACAGGTGCGCGCGGAGCTGGAACGCCAGCTGCGCGACATGGT
CCCCGAGTCCCCTTCCGAAGTGCAGGTGCTCTTCGCGGGCTTCAAGCCCGAGGACGGCTACCGGCTCGTG
GAGACCGACTTCCTCCTGGATGGCGAACCGCTCGCCGTCCCGGGGCTGGACGAGCTCAACGCGCCCGGCG
TCCACCGGCTCGCGAACCTGAAGGTCGAACCCGGCGAGCACACCCTCGTCTCGCGCGTCACGTACACCAA
CGGCTCCTGGAGCCTGTTCAGCGAGACCAACGGCTTCCTCTGGAAGATCACCGCCTCCGTCGGCTTCCAG
ACCCAGCGCGGCCTGCGCGTCGTGGTGAAGGCCTCCCCCAGCGTGGTGCCCAACGCGCCGGATCCGCGCC
TCAAGCTCAAGCTCACCCACGCCGTCACCGCGGAGATGATCCAGCCGCTGAAGGACGAGCCCGCCGTCGT
CACCGCGCCGCCCGTGAAGCCCGCGCCCGTGGATGCCGGCGCCCCGGTGAAGGTCGCCCAGCCCACGCCG
CCGCCGGACGCGGGCGTGAAGCCCACGACGACCGTCGTCTCCGTGACGCCGCCCGTGGAGCGCCCGCCGG
TGGCCGCCAGCCGCCTGCGCCTCCAGGTGACGTCGAAGAAGCCCACCTCCGCCACCGCCTTCGTGCGCGG
TCCGGGCGAGCCCCTCAAGCTCACCGTGCCCGGCAAGAAGCCGCAGGACGTGCCCCTGTCCGCGGGCGCG
TACACCGTGGACCTCATCGCCGACGGCTTCCTCGCGCAGACGCGCCAGGTGGTGCTGGCCGCCGGGGCGG
ACACGTCGCTCGCCTTCGCGCTGGTGCCCGCGCCCAAGGCCGCCAAGGCCGCCAAGGTGCAGGAGGGCCG
CATCGAGCTGCCCCAGCCCCTGAGCTTCGACGAGAAGAAGCCCGTGCCCGCCAAGGCCTCGCTCGCGGGC
CTGGACCTGGCGGTGGACCTGCTCGTACGCGACCCGAAGGCCCGCCTGCGCATCGAAGGCCACACCGACT
CGAAGGAAGTCCCCGAGCCCGCGCGCCAGAGCCTCTCCGACGCCCGCGCCCGCGCCGTGGCCGACATGCT
GATCCGCGCCGGCGTGGCCCCGTCCCGAGTGGAGGCCGTGGGCCTGGGCGACCGCAGCCCCAAGGCCCCC
AACCTGATTCCTCGCGGCCGTGAGCTCAACCGCCGCGTGGAGCTGGTGCTGCTGCGCCCCTGA