SecReT6
Protein ID: 383495084
SecReT6 ID560
T6SS typei3
Gene symbolsciB
Locus tagUMN798_0291
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]305720..306715 [-]
ProductSPI-6 associated protein
NoteTssG
UniProt IDH8M570
KEGG IDsef:UMN798_0291
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-94, Aligned region: 10..310
Protein Sequence: 331 a.a.     [Download]
>gi|383495084|ref|YP_005395773.1| SPI-6 associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MTGALNQAQKTPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIAQVSWQDGRLH
LSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHHRWLTQFWQAWRSAQSAGGGLDKPEHD
RFAFYIASLSGQDLRESAESPLSDHVRLAASAHLVRESRNPDGLAATLAHYFSVPFAVKEFALHWITVAN
DEITRLGTPAQSSVLGNGALIGQAVPDMQYKFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYC
WEIELQLKPHAAPPAVIGGAQRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
 
Nucleotide Sequence: 996 bp     [Download]
>gi|383494824|ref|NC_017046.1|:c306715-305720 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
ATGACCGGCGCTCTCAACCAGGCGCAGAAAACCCCCTGGCGTTACGGATTCCTGAACCTGATGCGGCGCG
TGGATGCCCAGCTCTGTGATACTCCGGCAGGCAGTATCTGGCAGCCACGGATGGAAAAATTCCGTCTGGG
ACAGACGCCGACGATGACCTTTGCGCCACGGGAAATCGCCCAGGTCAGCTGGCAGGATGGACGCCTGCAC
CTGAGCCTGTACAGCCTCGGACTATGGGGGCCAAACGGCCCGTTGCCGCTGCACTATACCGAGCTGGCAC
TGAACCGCTCAGAGAGTCGTCACGATCCGACGCTGGTTCATTTTTCCAATATTTTTCACCACCGCTGGCT
GACGCAGTTCTGGCAGGCATGGCGCAGCGCCCAGTCCGCTGGTGGCGGGCTGGACAAACCGGAACACGAC
CGTTTTGCGTTTTATATCGCCAGTCTCAGCGGGCAGGATCTACGGGAAAGCGCCGAAAGCCCGCTGTCAG
ATCATGTTCGCCTGGCAGCCTCCGCCCATCTGGTACGCGAATCGCGCAATCCTGACGGGCTGGCCGCCAC
GCTGGCGCACTATTTCAGCGTACCTTTTGCGGTGAAAGAATTCGCCCTGCACTGGATAACGGTGGCGAAC
GATGAAATCACCCGTCTGGGCACGCCCGCGCAGTCTTCGGTGCTGGGCAACGGGGCGCTTATCGGCCAGG
CCGTACCGGATATGCAGTACAAATTCCGGCTAATTATCGGCCCGCTCACGCTGGAGGATTACCTGCGTTT
TCTGCCCGGCGGCAACAATCTGCCCGTGCTGACAGAACTGGTGCGTACGTTCATCGGTTTTGAATATTGC
TGGGAAATTGAGCTGCAGTTGAAGCCTCATGCCGCACCGCCTGCGGTGATCGGCGGCGCGCAGCGGCTTG
GCTGGACGGCCTGGGCAGGTAAAGCCATGCATGACCGTCCGGTGACCGGCATGATTTTTGAACCTGAACA
CGGCTTAACCCACTGA