SecReT6
Protein ID: 383495091
SecReT6 ID560
T6SS typei3
Gene symbolsciI
Locus tagUMN798_0298
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]314488..315981 [+]
ProductSPI-6 associated protein
NoteTssC
UniProt IDH8M577
KEGG IDsef:UMN798_0298
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.90E-190, Aligned region: 64..490
Protein Sequence: 497 a.a.     [Download]
>gi|383495091|ref|YP_005395780.1| SPI-6 associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAYKSISAIIAQI
DFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMF
KKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAVASPSVLQMDSWQELANPR
DLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAA
YAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPL
IHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQR
WLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLP
SVKQGNA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|383494824|ref|NC_017046.1|:314488-315981 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCTATTATTGCGCAGATC
GACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGAAGCTGGAATCCTCGT
GGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAATTCGCTTCATGAATCT
GTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGATCAAAGCCCGATGTTC
AAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTATCATTGCGGATTACT
ACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGCCGCGTCGGCCCATGC
GCCGTTTATTGCCGTGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAACTGGCGAATCCCCGC
GACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGCGGGCTAGCGAAGACT
CCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGCAAAAACCAACCCGGT
GGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTCTGGAGCAACGCGGCC
TACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGTTGATTCGCGGTGTGG
AATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGGCGGCGTGGACATGAA
ATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAACGGTTTTATCCCGTTG
ATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCACAGGAATACT
ACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTTCGCCTGCTCGCGCTT
CGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGTGAGGATATGCAGCGC
TGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGCAAGAAACTAAAGCCC
GTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGGTTATTACGACGCGAA
ATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTGGTGACAAAACTGCCG
TCAGTGAAGCAGGGCAATGCCTGA