SecReT6
Protein ID: 383495093
SecReT6 ID560
T6SS typei3
Gene symbol-
Locus tagUMN798_0301
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]317702..318142 [+]
ProductSPI-6 associated protein
NoteSTM0277 (e)
UniProt IDH8M579
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 3.10E-28, Aligned region: 25..126
Protein Sequence: 146 a.a.     [Download]
>gi|383495093|ref|YP_005395782.1| SPI-6 associated protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSGADNKFYIYRVNDMID
YLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCHLLNDPDNGPFVPEVG
TLWILP
 
Nucleotide Sequence: 441 bp     [Download]
>gi|383494824|ref|NC_017046.1|:317702-318142 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
GTGAATCATTCCGTCGCTGATGTGGGTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTT
ATTTTCAAAATGCCTGCCCTATTCGAATGAGCTATGTTTTGAATGCGACAGGGTTCCCAATAGCCCGTAA
CTCTCCGTATGCAAAGGTTAGTGGTGCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGAT
TATCTTACTCATACTATGGGCAAGCCTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATCGGGA
AGAAAGGAATTATCGTAGTAAAAGGGCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGG
CAGTATCTGTTCAGATCAGTGCCACTTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGG
ACACTGTGGATACTGCCGTGA