SecReT6
Protein ID: 383495096
SecReT6 ID560
T6SS typei3
Gene symbolsciN
Locus tagUMN798_0304
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]319250..319741 [+]
Productlipoprotein (SPI-6 associated)
NoteTssJ
UniProt IDH8M582
KEGG IDsef:UMN798_0304
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-41, Aligned region: 5..155
Protein Sequence: 163 a.a.     [Download]
>gi|383495096|ref|YP_005395785.1| lipoprotein (SPI-6 associated) [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKNDAAFTTADYWSLHDN
DKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIS
GKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|383494824|ref|NC_017046.1|:319250-319741 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
ATGCCTTTTGCACTGCTCCTGCTTTCCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGC
GACTCGACCTGAGCGTGAAAGCCTCCGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGA
GATACGTGTTTATGAACTGAAAAATGACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAAC
GACAAATCCGTCCTTACCGACGATTTAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAA
AACTGCGTCGCCCGCTGAATGCGCAGACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAA
ATCGGTCTGGCGGGTAACCTACAAAATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATATCG
GGGAAAGGAAAAGTGCAGTTGGAGGCGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAAT
GA