SecReT6
Protein ID: 383495107
SecReT6 ID560
T6SS typei3
Gene symbol-
Locus tagUMN798_0316
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 798
Repliconchromosome [GenBank: NC_017046] [Browse all T6SS(s) in this replicon]
Location [Strand]332525..333820 [+]
ProductRhs-family protein (SPI-6 associated)
NotePAAR
UniProt IDH8M593
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.00E-16, Aligned region: 71..140
RHS_repeat [PF05593], Evalue: 0.00097, Aligned region: 384..425
Protein Sequence: 431 a.a.     [Download]
>gi|383495107|ref|YP_005395796.1| Rhs-family protein (SPI-6 associated) [Salmonella enterica subsp. enterica serovar Typhimurium str. 798]
MYEAARVDDPIYHTSALAGFLIGAIIGIAIIALAAFAFFSCGFLAGLILGFMADQIASGVLQLGEAIGRS
IHHTAGKILTGSENVSTNSRPAARAVLSTVKCDNHIAEKRIAQGSENIYINSQPAARKDDHTECDAVIED
GSPNVFLGGGTQTVLEISSEIPDWLRKVVDVLFVVASLLGGLAGAWRQAAKLGTKFGTKCAAKFIGGELV
GMAVGEAISGLFSNPVDVTTGQKILLPETDFTLPGRLPVTCSRFYASHLETVGLLGRGWRLNWETSLRDD
DEHITLTGVQGRELRYPKTMLTPGHQIFDPEEQLYLSRLHDGRYVLHYTDRSYYVFGDFDSDGMAYLLFM
ETPHRQRIVFGHEGGRLVRIASSSGHHLLLHRTQTPAGERLSRIELVQGGTRGNLVEYRYDDNGQLTGVV
NRAGTQVRQFA
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|383494824|ref|NC_017046.1|:332525-333820 Salmonella enterica subsp. enterica serovar Typhimurium str. 798 chromosome, complete genome
ATGTATGAAGCAGCCCGTGTGGATGATCCTATCTACCACACCAGCGCGCTCGCCGGGTTTCTTATCGGCG
CTATCATCGGCATCGCCATTATCGCGCTTGCCGCCTTTGCCTTCTTTAGCTGCGGTTTTCTTGCCGGGCT
GATTCTGGGTTTTATGGCCGATCAAATAGCCTCCGGGGTATTGCAACTGGGCGAGGCCATCGGGCGCTCC
ATCCACCACACGGCAGGAAAAATCCTCACCGGTTCGGAGAATGTCAGCACCAACAGTCGCCCGGCGGCGC
GCGCGGTACTGAGTACGGTGAAATGCGATAACCATATCGCAGAAAAACGCATCGCCCAAGGGTCGGAAAA
TATCTACATCAACAGCCAGCCCGCCGCCCGTAAGGATGACCACACCGAATGCGACGCGGTGATTGAAGAC
GGTTCGCCGAATGTGTTTCTCGGCGGCGGCACACAGACGGTACTGGAAATCAGTTCTGAAATTCCGGACT
GGCTGCGCAAGGTGGTGGATGTATTGTTTGTCGTGGCGAGTCTGCTCGGCGGGCTGGCCGGGGCGTGGCG
GCAGGCGGCAAAGCTGGGGACGAAATTTGGCACTAAATGTGCCGCTAAGTTTATCGGCGGGGAGCTTGTC
GGGATGGCCGTGGGTGAGGCTATCAGCGGGCTGTTCAGCAATCCGGTGGATGTGACCACCGGGCAGAAAA
TCCTGCTGCCGGAAACGGACTTCACCCTGCCCGGTCGCCTGCCGGTCACCTGCTCGCGTTTTTACGCCAG
CCACCTGGAAACTGTGGGACTGTTGGGACGGGGCTGGCGGCTGAACTGGGAAACCAGCCTGCGCGATGAC
GATGAACACATCACGCTGACCGGCGTACAGGGGCGGGAACTGCGTTACCCGAAAACGATGCTGACGCCCG
GCCACCAGATATTTGACCCGGAAGAACAGTTATACCTCAGCCGCCTGCATGACGGGCGTTACGTGCTGCA
TTACACCGATCGCAGCTATTACGTATTTGGTGATTTTGACAGTGACGGCATGGCATACCTGCTGTTTATG
GAGACGCCGCACCGCCAGCGCATTGTCTTCGGGCACGAAGGAGGCAGACTGGTACGGATAGCCTCCAGCA
GCGGGCATCACCTGTTACTGCACCGCACACAGACCCCGGCAGGGGAGCGGCTGTCGCGAATTGAACTGGT
GCAGGGCGGCACCCGTGGCAATCTGGTGGAGTACCGGTATGACGATAACGGTCAACTGACCGGCGTGGTG
AACCGGGCGGGAACGCAGGTGCGTCAGTTTGCTTAA