SecReT6
Protein ID: 383758413
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25600
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2692824..2693438 [-]
Producthypothetical protein
NoteTssI
UniProt IDI0HSB2
KEGG IDrge:RGE_25600
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 6.00E-20, Aligned region: 31..134
Protein Sequence: 204 a.a.     [Download]
>gi|383758413|ref|YP_005437398.1| hypothetical protein RGE_25600 [Rubrivivax gelatinosus IL144]
MREAAGAPIAFDRLRSQHLVGRLAPRPSVHGVQTALVVGLGEPVHSDRDHRIKIQFHWQRGTRSSHRLAH
PAGDNAPASDASSTWVRVSEAVAGANWGSHFSPRLGQEVLVGFLGGDIDRPVVMGTVYNGLGRPDAQSNQ
TSAGAAGAGGCAPAWFPGAAAEGRLQAHQHGAVERSFLEHRAARDTVCRTFPRHLAVKRQDVVA
 
Nucleotide Sequence: 615 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2693438-2692824 Rubrivivax gelatinosus IL144, complete genome
GTGCGAGAAGCAGCCGGGGCACCGATAGCGTTTGACCGGCTTCGAAGCCAACACCTCGTCGGCCGCCTGG
CGCCGCGCCCCAGCGTGCACGGCGTGCAGACGGCCCTGGTCGTCGGCCTGGGCGAGCCGGTTCACAGCGA
CCGCGACCACCGCATCAAGATCCAGTTCCACTGGCAGCGCGGCACGCGCTCCAGCCACCGGCTGGCACAC
CCGGCAGGCGACAACGCACCGGCGTCAGACGCCAGCAGCACCTGGGTCCGGGTATCGGAGGCCGTGGCCG
GCGCCAACTGGGGCAGCCACTTCAGCCCGCGCCTGGGCCAGGAAGTGCTGGTCGGCTTTCTCGGCGGTGA
CATCGACCGCCCGGTGGTGATGGGGACGGTCTACAACGGCCTTGGCCGCCCCGATGCCCAGAGCAACCAG
ACCAGCGCCGGTGCTGCTGGCGCTGGTGGCTGCGCGCCGGCCTGGTTTCCTGGCGCGGCTGCGGAAGGCC
GGCTACAGGCGCACCAGCACGGCGCCGTGGAGCGAAGTTTCTTGGAGCATCGGGCTGCACGAGACACGGT
CTGTCGCACGTTTCCCAGACACCTAGCTGTGAAGCGTCAAGACGTTGTTGCCTGA