SecReT6
Protein ID: 383758421
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25680
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2701053..2704103 [-]
Producthypothetical protein
NoteTssI
UniProt IDI0HSC0
KEGG IDrge:RGE_25680
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-68, Aligned region: 54..368
Phage_GPD [PF05954], Evalue: 5.70E-68, Aligned region: 678..700
Phage_GPD [PF05954], Evalue: 5.70E-68, Aligned region: 820..839
DUF2345 [PF10106], Evalue: 1.20E-34, Aligned region: 743..902
T6SS_Vgr [PF13296], Evalue: 4.30E-31, Aligned region: 596..703
T6SS_Vgr [PF13296], Evalue: 4.30E-31, Aligned region: 824..837
Phage_base_V [PF04717], Evalue: 1.50E-19, Aligned region: 440..543
Protein Sequence: 1016 a.a.     [Download]
>gi|383758421|ref|YP_005437406.1| hypothetical protein RGE_25680 [Rubrivivax gelatinosus IL144]
MSLADELIATLLGAPTQNERLLRLHTPLGANVLLAERLDGIEAVAPSADVPAGLRFTVHALATSAHLDFK
QLIGQPVLLELELADASLRPWHGHVTAVGLEGSDGGLARYRLTVEPWLAFLGHRQDSWVFQDRSVMQIVD
EVFADYQGQGRLAPAWRWDLADESVYPRRSLCIQFQETDLAFVLRLLREEGLFGWFEHIAAPDDDTLGGH
TFVIADHNTAFATNRQPRVRYTQSGASLSEDSLVRWQRSVSVQAARLALASPDYRAGPQDAALRRASAVG
SSAPVDALGLSDVPGQYAYEDGAQGERLARRQMEALDARRERVQGSGSWRSAAPGSTFTLTDHPVHDGSD
DSRDRFAILAVRHRARNNLRADVKAGIDSLLGTIRRDAAGRSAELPNDSDEPLYQSTVTAQRAAVPVRLA
ADDEAGLPDPRLASRPSVHGVQTALVVGLGEPVHTDRDHRIKIQFHWQRGARSSHRLAHPAGDNAPASDA
SSTWVRVSEAVAGANWGSHFSPRVGQEVLVGFLGGDIDRPVVMGTVYNGLGRPDAQSNQTSAGAAGAGGC
APAWFPGEAAEGRLQAHQHGAVFSGHKSQELASSASGSGGCNQLVLDDSPGQGRIELSSSSAQTRLQIGH
LLQQTDNRRQQPRGHGLDLATQAWGAVRAASGLLISAHGKPGSTAGAMQLDTREPRTQLEQSAELARTLA
DSAHQRDARLPGDPEPAAMSSTKGLLASQDSLKGSDTTGDGSSSGGAGTVPTLTRPDIVIAAPGGITGST
PAHTVASAGNTASFVAGQDLQQLAQANSATVVKDGLVFFTYGTAQNPRKPNTETGVQLHAATGNVNTQSQ
QGATRLTADRAVSVASTHGMVKVTAPQHILLTAAGAAIRIEGGNITLSAPGKVEFRAAMKELGAGRSASL
DKPQLPRPQALTLRPSDPIHAELLDAQGIPADWLPTAFSAAVVLDASGKRLGRHSLSQPMANVVQTERTE
PIAYRLTSDSGTSWLVEEYIDEPPADDDTEAVDDEQ
 
Nucleotide Sequence: 3051 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2704103-2701053 Rubrivivax gelatinosus IL144, complete genome
ATGAGCCTCGCCGACGAGCTGATCGCCACGCTGCTGGGCGCACCAACGCAGAACGAACGGCTGCTGCGCC
TGCACACCCCGTTGGGCGCGAACGTGCTCTTGGCCGAACGGCTGGATGGCATCGAGGCCGTCGCACCTTC
GGCCGATGTCCCGGCCGGCCTGCGCTTCACGGTGCACGCACTGGCCACCAGCGCCCACCTCGACTTCAAG
CAGCTGATCGGCCAGCCGGTACTGCTGGAGCTGGAGCTGGCCGACGCCAGCCTGCGACCGTGGCACGGCC
ACGTCACGGCGGTGGGGTTGGAAGGCAGCGACGGCGGCTTGGCTCGTTACCGCCTCACGGTCGAGCCCTG
GCTCGCGTTCCTGGGCCATCGGCAGGACAGCTGGGTGTTCCAGGACCGAAGCGTGATGCAGATCGTCGAC
GAGGTGTTCGCCGACTACCAGGGACAAGGCAGGCTGGCGCCCGCCTGGCGCTGGGACCTGGCCGACGAGA
GCGTCTACCCGCGGCGCAGCCTGTGCATCCAGTTCCAGGAGACCGACCTCGCCTTCGTGCTGCGCCTGCT
GCGCGAAGAAGGCCTGTTCGGCTGGTTCGAGCACATTGCAGCCCCCGACGACGACACCCTGGGCGGGCAC
ACCTTCGTCATCGCCGACCACAACACCGCATTCGCGACGAACCGGCAGCCCCGCGTGCGCTACACCCAGT
CTGGCGCCAGCCTGTCCGAGGACAGCCTCGTGCGCTGGCAGCGCAGCGTCAGCGTGCAGGCCGCGCGGCT
GGCGCTGGCCAGCCCCGACTACCGGGCCGGCCCGCAAGACGCCGCGCTGCGCCGGGCGAGCGCCGTCGGC
AGCAGCGCGCCGGTGGACGCACTCGGCCTGAGCGACGTGCCGGGGCAGTACGCCTACGAAGACGGCGCCC
AGGGCGAGCGTCTGGCGCGCCGCCAGATGGAAGCGCTGGACGCACGGCGCGAGCGTGTGCAGGGTTCGGG
CAGCTGGCGCAGCGCAGCGCCGGGCAGCACCTTCACGCTGACCGATCATCCCGTGCACGACGGCAGCGAC
GACAGCCGCGACCGCTTCGCCATCCTGGCGGTGCGGCACCGAGCTCGCAACAACCTGCGCGCCGACGTCA
AGGCCGGCATCGACAGCCTGCTGGGCACCATCCGGCGAGATGCCGCGGGACGCAGCGCCGAGTTGCCCAA
TGACAGCGATGAGCCGCTCTACCAGAGCACCGTCACTGCCCAGCGCGCCGCGGTGCCGGTGCGCCTGGCC
GCGGACGACGAGGCCGGCCTGCCCGACCCGCGCCTGGCGTCGCGCCCCAGCGTGCACGGCGTGCAGACGG
CCCTGGTCGTCGGCCTGGGCGAGCCGGTGCATACCGACCGCGACCACCGCATCAAGATCCAGTTCCACTG
GCAGCGCGGCGCGCGCTCCAGCCACCGGCTGGCACACCCGGCAGGCGACAACGCACCGGCGTCAGACGCC
AGCAGCACCTGGGTCCGGGTATCGGAGGCCGTGGCCGGCGCCAACTGGGGCAGCCACTTCAGCCCGCGCG
TGGGCCAGGAAGTGCTGGTCGGCTTTCTCGGCGGTGACATCGACCGCCCGGTGGTGATGGGGACGGTCTA
CAACGGCCTTGGCCGCCCCGATGCCCAGAGCAACCAGACCAGCGCCGGTGCTGCTGGCGCTGGTGGCTGC
GCGCCGGCCTGGTTCCCAGGCGAGGCCGCCGAAGGCCGGTTGCAGGCGCACCAGCACGGCGCCGTGTTCA
GCGGCCACAAGAGCCAGGAACTCGCCAGCAGCGCGAGCGGCAGCGGCGGCTGCAACCAGTTGGTACTCGA
CGACAGCCCGGGCCAGGGCCGCATCGAGCTGTCCAGTAGCAGCGCGCAGACGCGGCTGCAGATCGGCCAC
CTGCTGCAGCAGACCGACAACCGCCGCCAGCAGCCGCGCGGCCACGGCCTGGACCTGGCCACGCAAGCCT
GGGGCGCCGTGCGTGCGGCCAGCGGCTTGTTGATCAGCGCGCACGGCAAGCCCGGCAGCACCGCTGGCGC
CATGCAACTGGACACCCGCGAGCCTCGGACCCAACTCGAACAATCCGCCGAACTGGCCCGGACCCTGGCC
GACAGCGCGCATCAGCGCGACGCCCGGCTCCCAGGCGATCCCGAGCCCGCGGCGATGAGCTCCACCAAGG
GCCTGCTCGCCAGCCAGGACAGCCTCAAGGGCAGCGATACCACCGGCGACGGCAGCAGCAGCGGCGGCGC
AGGCACCGTGCCCACGCTGACGCGGCCGGACATCGTCATCGCCGCACCGGGCGGCATCACCGGCAGCACA
CCCGCGCACACCGTCGCCAGCGCCGGCAACACCGCCAGCTTCGTCGCCGGGCAGGACCTGCAGCAGTTGG
CGCAGGCCAACAGCGCCACCGTCGTCAAGGATGGCCTCGTCTTCTTCACCTACGGCACAGCGCAGAACCC
GCGCAAGCCCAACACCGAGACGGGCGTCCAGCTGCACGCGGCCACCGGCAACGTGAACACGCAGAGCCAG
CAAGGGGCGACACGGCTCACCGCCGACCGCGCCGTCAGCGTGGCCAGCACCCATGGGATGGTGAAGGTGA
CGGCACCGCAGCACATCCTGCTCACCGCCGCCGGGGCGGCCATACGCATAGAGGGCGGGAACATCACGCT
CTCGGCGCCGGGCAAGGTGGAGTTCAGGGCCGCGATGAAAGAGCTGGGGGCGGGCAGGAGCGCGTCACTC
GACAAGCCGCAACTTCCACGGCCGCAGGCCTTGACGCTACGCCCCTCCGATCCGATCCACGCCGAATTGC
TCGATGCGCAAGGCATTCCGGCGGACTGGCTGCCGACGGCGTTCTCCGCTGCTGTCGTTCTGGATGCGTC
CGGCAAGCGGCTCGGCCGGCATTCCTTGAGCCAGCCTATGGCGAATGTCGTTCAGACCGAACGGACAGAA
CCTATTGCATACCGGCTGACGTCCGACAGCGGAACGTCCTGGCTTGTCGAAGAGTACATCGACGAGCCCC
CTGCAGACGACGACACGGAGGCGGTCGACGATGAGCAGTAA