SecReT6
Protein ID: 383758423
SecReT6 ID565
T6SS typei4b
Gene symbolclpV
Locus tagRGE_25700
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2704453..2707116 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDI0HSC2
KEGG IDrge:RGE_25700
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-43, Aligned region: 225..242
AAA_2 [PF07724], Evalue: 3.10E-43, Aligned region: 616..785
AAA [PF00004], Evalue: 5.50E-19, Aligned region: 225..356
AAA [PF00004], Evalue: 5.50E-19, Aligned region: 622..740
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 225..245
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 284..355
AAA_5 [PF07728], Evalue: 1.20E-13, Aligned region: 621..740
ClpB_D2-small [PF10431], Evalue: 1.80E-12, Aligned region: 793..866
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 57..84
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 202..246
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 411..492
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 614..658
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 687..710
AAA_16 [PF13191], Evalue: 1.10E-10, Aligned region: 787..816
Clp_N [PF02861], Evalue: 1.70E-10, Aligned region: 23..74
Clp_N [PF02861], Evalue: 1.70E-10, Aligned region: 111..133
AAA_22 [PF13401], Evalue: 6.80E-08, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 6.80E-08, Aligned region: 345..385
AAA_22 [PF13401], Evalue: 6.80E-08, Aligned region: 618..643
AAA_22 [PF13401], Evalue: 6.80E-08, Aligned region: 683..715
Sigma54_activat [PF00158], Evalue: 8.60E-06, Aligned region: 204..239
Sigma54_activat [PF00158], Evalue: 8.60E-06, Aligned region: 618..738
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 220..249
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 281..318
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 439..506
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 617..639
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 50..111
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 225..272
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 471..490
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 621..658
AAA_29 [PF13555], Evalue: 5.40E-05, Aligned region: 217..241
AAA_29 [PF13555], Evalue: 5.40E-05, Aligned region: 617..646
AAA_19 [PF13245], Evalue: 8.70E-05, Aligned region: 225..247
AAA_19 [PF13245], Evalue: 8.70E-05, Aligned region: 618..643
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 209..244
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 621..639
NACHT [PF05729], Evalue: 0.00015, Aligned region: 225..253
NACHT [PF05729], Evalue: 0.00015, Aligned region: 622..646
Zeta_toxin [PF06414], Evalue: 0.00068, Aligned region: 129..151
Zeta_toxin [PF06414], Evalue: 0.00068, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 0.00068, Aligned region: 466..496
Zeta_toxin [PF06414], Evalue: 0.00068, Aligned region: 613..661
Arch_ATPase [PF01637], Evalue: 0.00089, Aligned region: 204..239
Arch_ATPase [PF01637], Evalue: 0.00089, Aligned region: 277..362
Arch_ATPase [PF01637], Evalue: 0.00089, Aligned region: 620..660
Arch_ATPase [PF01637], Evalue: 0.00089, Aligned region: 692..715
AAA_18 [PF13238], Evalue: 0.0013, Aligned region: 225..248
AAA_18 [PF13238], Evalue: 0.0013, Aligned region: 623..651
AAA_23 [PF13476], Evalue: 0.0041, Aligned region: 225..242
AAA_23 [PF13476], Evalue: 0.0041, Aligned region: 460..504
AAA_23 [PF13476], Evalue: 0.0041, Aligned region: 618..652
T2SE [PF00437], Evalue: 0.0059, Aligned region: 200..242
T2SE [PF00437], Evalue: 0.0059, Aligned region: 592..658
SRP54 [PF00448], Evalue: 0.0076, Aligned region: 225..245
SRP54 [PF00448], Evalue: 0.0076, Aligned region: 620..652
Protein Sequence: 887 a.a.     [Download]
>gi|383758423|ref|YP_005437408.1| type VI secretion ATPase, ClpV1 family [Rubrivivax gelatinosus IL144]
MPDKLKTLIAKLDDGCRRAAERAASLCLARGHYEVDVEHIFLALLEQPQSDLALICRRHDVSTSALQRDL
EAELARLRSGNTRTPVFSPRVPVLLEHAWLVASLDSHLPRIRSAHLLLALLTESSLAQVAQRASSHFARF
RVDDLKHRLAELTDGSAESDGAVRVPDAAAGGEPALAGRTPALDQFTTDLTQRAAAGRLDPVIGRDAEIR
QVIDILMRRRQNNPILTGEAGVGKTAVVEGLALRIAAGDVPPALQGVSLHVLDLGLLQAGASVKGEFENR
LKTVIDEVKKSPHPVILFIDEAHTMIGSGGTAGQNDAANLLKPALARGELRTVAATTWSEYKKYFEKDAA
LARRFQVVKVEEPSEPIAAAMLRGMAALMEQHFKVRVLDEAVTEAVRLSARYINGRQLPDKAIGVLDTAC
AKVALGQSSTPAPIEDAARRIERLDAEAVALRREAAAGADHEAKLAELAAKRDSVQADLDALKTRFEAEK
ALVAEIQALRAELEAAPPCAADPAARKKSAKKPGAGPTALHARLDELAALQGETPLVPMQVDGLVVAEIV
SAWTGIPLGKMVRNEIATVMNLKALLQERVIGQDHALAAVAQRVRTARANLEDPGKPKGVFLFVGPSGVG
KTETALALADLLYGGERKLVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVE
KAHPDVLELFFQVFDKGVLEDAEGREVDFRNTIIVLTSNVGSSQIMQACLNKAPADLPAADALAEALRPV
LYKSFKPAFLGRLKVVPFYPIGDAVLEQIIRLKLDRIARRVAGNHRADFRYDDKLVEAVLARCTEVDTGA
RNIDHILNGTLLPEVAEQVLARMADGTAIERIKVTAVRNGDFRYAVS
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2707116-2704453 Rubrivivax gelatinosus IL144, complete genome
ATGCCCGACAAGCTCAAGACCCTGATTGCCAAACTCGACGACGGCTGCCGGCGTGCTGCCGAGCGCGCCG
CCAGCCTGTGCCTGGCGCGCGGCCACTACGAGGTGGATGTCGAACACATCTTCCTGGCCCTGCTGGAACA
GCCGCAGAGTGACCTTGCGCTGATCTGCAGGCGCCACGACGTGTCTACCAGCGCACTGCAGCGAGATTTG
GAGGCCGAACTGGCGAGGCTTCGAAGCGGCAACACGCGCACGCCGGTGTTCAGTCCGCGCGTGCCTGTGC
TGCTGGAACATGCCTGGCTCGTGGCGTCGCTCGACTCACATCTGCCGCGCATCCGCAGTGCGCACCTGCT
GCTGGCCTTGCTGACCGAGTCGTCGCTCGCACAAGTCGCCCAGCGAGCCAGCAGTCATTTCGCGCGCTTT
CGGGTCGACGACCTGAAGCACCGCCTGGCCGAGCTGACCGACGGCTCAGCCGAATCCGACGGCGCCGTGC
GCGTACCCGATGCAGCAGCCGGCGGCGAGCCCGCCTTGGCGGGCCGGACGCCGGCACTGGACCAGTTCAC
CACCGACCTCACGCAACGCGCTGCTGCGGGCCGGCTCGATCCGGTGATCGGCCGAGACGCCGAGATCCGT
CAGGTCATCGACATCCTGATGCGCAGACGCCAGAACAACCCCATCCTCACCGGCGAGGCGGGTGTCGGCA
AGACGGCCGTGGTGGAGGGGCTGGCACTGCGCATCGCCGCGGGGGACGTGCCGCCTGCGCTGCAGGGCGT
GAGCCTGCATGTGCTGGATCTGGGCCTGCTGCAGGCCGGCGCCAGCGTCAAGGGCGAGTTCGAGAACCGC
CTGAAGACCGTGATCGACGAGGTCAAGAAGAGCCCGCATCCCGTCATCCTGTTCATCGACGAAGCGCACA
CGATGATCGGCTCCGGCGGCACCGCCGGCCAGAACGACGCCGCCAACCTGCTGAAGCCCGCGCTGGCCCG
GGGCGAGCTGCGCACCGTCGCCGCGACCACGTGGAGCGAGTACAAAAAGTACTTCGAGAAAGACGCCGCG
CTCGCCCGCCGCTTCCAGGTCGTGAAGGTCGAGGAGCCGAGCGAGCCCATCGCCGCAGCGATGCTGCGCG
GCATGGCAGCGCTGATGGAGCAGCACTTCAAGGTCCGCGTGCTCGACGAGGCCGTAACTGAAGCCGTGCG
GCTTTCGGCGCGCTACATCAACGGCCGGCAACTGCCCGACAAGGCGATCGGTGTGCTGGATACCGCGTGT
GCAAAGGTCGCACTGGGGCAGAGTTCGACGCCGGCACCGATCGAGGACGCCGCGCGCCGCATCGAGCGGC
TCGATGCCGAAGCCGTCGCGCTGCGGCGTGAAGCCGCCGCCGGCGCCGACCACGAGGCGAAGCTGGCCGA
ACTGGCCGCCAAGCGCGACTCGGTGCAGGCGGACCTGGACGCGCTCAAGACCCGCTTCGAGGCCGAGAAG
GCGTTGGTCGCCGAGATCCAGGCGCTGCGTGCGGAGCTGGAAGCCGCGCCTCCATGTGCGGCCGATCCGG
CGGCCAGGAAGAAGAGCGCGAAGAAGCCCGGCGCCGGGCCCACCGCCCTGCACGCCCGCCTCGACGAGCT
CGCGGCGCTGCAAGGCGAGACCCCGCTGGTGCCGATGCAGGTCGACGGGCTGGTCGTCGCCGAGATCGTC
TCCGCCTGGACCGGCATCCCGCTGGGCAAGATGGTCAGGAACGAGATCGCCACCGTCATGAACCTGAAGG
CGCTGCTCCAGGAGCGCGTCATCGGCCAGGACCACGCGCTCGCCGCCGTCGCCCAGCGCGTGCGCACCGC
GCGCGCCAACCTCGAAGACCCGGGCAAGCCCAAGGGCGTGTTCCTGTTCGTCGGGCCCAGTGGCGTCGGC
AAGACCGAGACCGCGCTCGCCCTCGCTGACCTGCTCTACGGCGGCGAGAGAAAGCTTGTGACTATCAACA
TGAGCGAGTACCAGGAGGCGCACTCAGTCAGCGGCCTCAAGGGCAGCCCGCCAGGCTACGTCGGCTACGG
CGAGGGCGGTGTGCTCACCGAGGCCGTACGCCGCAACCCGTACAGCGTGGTGCTGCTCGACGAGGTGGAG
AAGGCCCACCCTGACGTGCTGGAGCTCTTCTTTCAGGTCTTCGACAAGGGCGTGCTCGAAGACGCCGAAG
GTCGCGAGGTCGACTTCCGCAACACGATCATCGTCCTCACGAGCAACGTCGGCTCCAGCCAGATCATGCA
GGCCTGCCTGAACAAGGCACCGGCCGATTTGCCAGCGGCCGATGCGCTGGCCGAGGCGCTGCGCCCGGTT
CTGTACAAGAGCTTCAAGCCTGCGTTCCTGGGACGTCTGAAGGTGGTGCCCTTCTACCCTATCGGCGACG
CCGTGCTGGAGCAGATCATCCGCCTCAAGCTCGACCGCATCGCGCGCCGCGTAGCCGGCAACCACCGGGC
CGACTTCCGGTATGACGACAAGCTGGTCGAGGCGGTTCTCGCGCGCTGCACCGAGGTCGACACCGGCGCC
CGCAACATCGACCACATCCTCAACGGCACGCTGCTGCCCGAGGTGGCCGAGCAGGTGCTGGCCCGCATGG
CCGACGGCACGGCGATCGAGCGCATCAAGGTCACCGCGGTGCGCAACGGCGACTTCCGTTATGCGGTCAG
CTAG