SecReT6
Protein ID: 383758424
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25710
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2707126..2708196 [-]
Producthypothetical protein
NoteTssG
UniProt IDI0HSC3
KEGG IDrge:RGE_25710
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.30E-88, Aligned region: 18..336
Protein Sequence: 356 a.a.     [Download]
>gi|383758424|ref|YP_005437409.1| hypothetical protein RGE_25710 [Rubrivivax gelatinosus IL144]
MPPAQRRQPPAVITRLLEEPHGFGFFQALRLLERWFRRQEGLSSAQVLGQRLAVRNPLSLSFPASEIAHL
SMEGDLHSDDGVPQSLGLRRIALTPAFIGLLGAGGALPHYYTELLAEREAYHRDRAGRAFLDIFLHRATV
LFYQGWQKHRLPVQFEADRSNRYLPLVLSLAGLGHAGVRQRLQASKGGVADDALAFFAGTLQRRPLSAVA
LQRVLQQHFGVPVRLEQFIGRWFTLPRANQSHLGLKNMRLGHDVVMGERVWQRDLRLRLTFGPLTRRRFA
RFLPGGPAALALAELLGLMTGGTLEYEVRLTLRAEDVHGITLDGSSSARLGWDSFLVTEPVRQDRSDLGY
DLLALA
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2708196-2707126 Rubrivivax gelatinosus IL144, complete genome
GTGCCCCCGGCGCAGCGGCGGCAGCCCCCTGCTGTAATCACGCGGCTGCTGGAAGAGCCGCACGGTTTCG
GCTTCTTTCAGGCGCTGCGGTTGCTGGAGCGATGGTTTCGCCGGCAAGAAGGACTGTCTTCCGCGCAGGT
GTTGGGGCAGCGGCTGGCGGTACGCAACCCGCTGTCGCTGTCGTTTCCCGCCAGCGAGATCGCCCACCTG
TCGATGGAAGGGGATCTGCACTCCGACGACGGCGTGCCGCAGTCGCTCGGCCTGCGACGCATCGCGCTCA
CGCCGGCCTTCATCGGACTGCTGGGCGCCGGCGGTGCCCTGCCCCACTACTACACCGAACTCCTCGCCGA
ACGCGAGGCCTACCACCGCGATCGCGCGGGCCGCGCCTTCCTGGACATCTTCCTCCACCGCGCGACGGTG
CTCTTCTACCAAGGCTGGCAGAAGCACCGTCTGCCGGTGCAGTTCGAGGCCGACCGCAGCAACCGTTACC
TGCCGCTGGTGCTGTCGCTGGCCGGCCTCGGCCATGCCGGCGTGCGCCAACGCCTGCAGGCCAGCAAGGG
CGGCGTGGCCGACGACGCGCTGGCTTTCTTTGCCGGCACCCTGCAGCGCCGGCCGCTGTCGGCCGTGGCA
CTGCAGCGCGTGCTGCAGCAGCACTTCGGCGTGCCGGTGCGGCTGGAGCAGTTCATCGGCCGCTGGTTCA
CGCTGCCGCGAGCCAACCAGTCGCACCTGGGCCTGAAGAACATGCGGCTGGGCCACGACGTGGTGATGGG
CGAGCGTGTCTGGCAGCGCGATCTGCGGCTGCGCCTGACCTTCGGCCCGTTGACGCGCCGTCGCTTCGCC
CGCTTCCTGCCCGGCGGCCCGGCAGCGCTGGCGCTGGCCGAACTGCTGGGGCTGATGACTGGCGGCACGC
TCGAATACGAAGTCCGCCTGACGCTGCGCGCCGAAGATGTGCATGGCATCACCCTCGATGGCAGTTCGTC
CGCCCGTCTGGGCTGGGACAGTTTTCTCGTCACCGAACCCGTTCGACAGGACCGTAGCGATCTGGGCTAC
GACCTGCTGGCTCTGGCCTGA