SecReT6
Protein ID: 383758425
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25720
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2708160..2710007 [-]
Producthypothetical protein
NoteTssF
UniProt IDI0HSC4
KEGG IDrge:RGE_25720
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.20E-194, Aligned region: 4..615
Protein Sequence: 615 a.a.     [Download]
>gi|383758425|ref|YP_005437410.1| hypothetical protein RGE_25720 [Rubrivivax gelatinosus IL144]
MKDLLPHYERELAFLRQHAGDFAQRYPKIAGRLMLSGDVGEDPHVERLIEAFALLTSRIHKRLDDDFPLF
TESLLEVLYPHYLRPFPSCAVARLDVGGGAAQLTQGGVLPRGSLLSSRPVHGVTCRFRTAFSTALLPLRV
VSAAFRGAVQAPDGTPVPPGATTLLSVELALVSPQARWSTLGAEAIRLHIDGEASQVAAVREAFFGRVQG
ALLQTSPHGPWQAAADAWPREVGFAEDEALIDFDARSHPAYRLLTEYFAFPEKFNFVDLPLPAALRDCAA
RSVTLHFPLSGVRSDSDEARLLETLTERNLLLGCTPVVNLFRQRAEPIRVTHSAEAYPVLPDARRAFGFE
VHSVERVWRVRQSAQGEAIDEFRPFYSLQHDDLLADGEAAGRYWYVRRNEVVAEASPGFETELAIVDVDF
DPAQPQTDTLSLEVMATNRDLPSQLSIANPGGDLFQDGGGIAREIRLLRKPTPTVRFERGRGALWRLISH
LSLNHLSLSGGGIEALKEMLRLYDLPRSTSNRSVLEGLRGIDYRAATACLPGDPFPCFVRGIEVRLLVEE
QRFAGSGLRLFAQVLDHFFGLYVHANSFTQLKLVSDRTQEELVTCPRRSGGSPLL
 
Nucleotide Sequence: 1848 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2710007-2708160 Rubrivivax gelatinosus IL144, complete genome
ATGAAAGATCTGCTGCCGCACTACGAGCGCGAACTGGCGTTTCTACGCCAGCACGCGGGCGACTTTGCGC
AGCGCTACCCCAAGATCGCCGGCCGGCTCATGCTGAGCGGAGACGTCGGCGAGGACCCGCACGTCGAACG
CCTGATCGAGGCCTTCGCCCTCCTGACCTCGCGCATCCACAAGCGGTTGGACGACGACTTCCCGCTGTTC
ACCGAGTCATTGCTGGAGGTGCTGTACCCGCACTATCTGCGGCCCTTCCCGTCCTGTGCGGTCGCGCGTC
TGGATGTGGGCGGCGGTGCGGCGCAGCTCACGCAAGGCGGCGTGCTGCCGCGAGGCAGCCTGCTCAGCAG
CCGGCCGGTGCATGGCGTCACGTGCCGGTTCCGAACCGCCTTCTCCACGGCACTGCTGCCGCTGCGCGTA
GTGTCGGCCGCCTTTCGCGGGGCCGTGCAGGCACCCGACGGCACGCCGGTGCCGCCCGGCGCGACCACAC
TTTTATCGGTGGAACTGGCGCTGGTGTCGCCGCAGGCCCGCTGGTCGACGCTGGGCGCCGAGGCGATCCG
GCTGCACATCGATGGCGAGGCTTCGCAGGTCGCCGCGGTGCGCGAAGCCTTCTTCGGCCGCGTGCAGGGC
GCGTTGCTCCAGACCTCCCCCCACGGCCCCTGGCAGGCCGCAGCCGATGCATGGCCGCGCGAGGTGGGCT
TCGCCGAAGACGAGGCTCTGATCGATTTCGACGCGCGCTCCCATCCCGCGTACCGCCTGCTCACCGAGTA
CTTCGCCTTCCCGGAGAAGTTCAACTTCGTCGACCTGCCGCTGCCCGCTGCGCTAAGGGATTGCGCCGCT
CGCAGCGTCACGCTGCATTTCCCCCTGAGCGGCGTGCGCAGCGATTCCGATGAGGCACGTCTTCTTGAAA
CACTCACGGAGCGCAACCTTCTGCTGGGCTGCACCCCGGTGGTCAACCTGTTTCGCCAGCGCGCCGAGCC
GATCCGCGTGACGCACAGCGCCGAGGCCTACCCGGTGTTGCCCGACGCACGGCGCGCTTTCGGTTTCGAG
GTCCACTCGGTTGAACGGGTCTGGCGCGTGCGCCAGTCTGCGCAGGGGGAGGCAATCGACGAGTTCCGCC
CGTTCTACTCGCTGCAGCACGACGATTTACTGGCCGACGGCGAGGCCGCTGGCCGTTACTGGTACGTGCG
ACGCAATGAGGTGGTGGCCGAGGCCAGCCCGGGTTTCGAGACCGAACTGGCCATCGTCGACGTCGACTTC
GACCCCGCACAGCCGCAGACCGACACCTTGTCGCTTGAGGTGATGGCGACCAACAGGGACCTGCCTAGCC
AGCTGTCGATCGCAAACCCTGGCGGCGATCTCTTCCAGGACGGAGGCGGCATCGCACGCGAGATTCGCCT
GCTGCGCAAACCCACGCCAACAGTGCGCTTCGAGCGCGGGCGTGGTGCGCTGTGGCGGCTGATATCGCAC
CTGTCCCTGAACCATCTGTCGCTGTCGGGCGGTGGCATCGAGGCGTTGAAGGAGATGCTGCGCCTCTACG
ACCTGCCGCGTAGCACCAGCAACCGCAGCGTGCTGGAAGGCCTGCGCGGCATCGACTACCGGGCGGCCAC
GGCCTGCCTGCCGGGTGACCCCTTTCCCTGCTTCGTGCGGGGCATCGAGGTGCGACTGCTGGTCGAAGAA
CAGCGCTTCGCCGGCAGCGGCCTGCGCCTGTTCGCGCAGGTGCTGGACCATTTCTTCGGCCTGTACGTGC
ACGCCAACAGCTTCACCCAGTTGAAGCTGGTGTCGGATCGCACGCAGGAGGAGCTCGTCACGTGCCCCCG
GCGCAGCGGCGGCAGCCCCCTGCTGTAA