SecReT6
Protein ID: 383758426
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25730
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2710004..2710489 [-]
Producthypothetical protein
NoteTssE
UniProt IDI0HSC5
KEGG IDrge:RGE_25730
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-22, Aligned region: 26..131
Protein Sequence: 161 a.a.     [Download]
>gi|383758426|ref|YP_005437411.1| hypothetical protein RGE_25730 [Rubrivivax gelatinosus IL144]
MQRFAPYLLDRLIDASPEDATRPMLTLEQLKDTVARDVEALLNSRRGGGADDMRGHVLARRSVLAFGLDD
FAARSMASTTDQAFICHAIERAIDDHEPRLRNVRVQLNPREVSKQNLKFTIRAMLKVHPMQAPVNFDAML
QTSTQQYAVTAARRPAAETAP
 
Nucleotide Sequence: 486 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2710489-2710004 Rubrivivax gelatinosus IL144, complete genome
ATGCAGCGCTTTGCGCCGTACCTGCTCGACCGGCTCATCGACGCCTCGCCCGAAGACGCGACGCGACCGA
TGCTCACGCTCGAACAGCTGAAGGACACCGTCGCTCGCGACGTGGAGGCGCTCCTGAACTCTCGTCGCGG
CGGCGGCGCGGATGACATGCGCGGCCATGTGCTCGCACGGCGTTCGGTTCTGGCCTTCGGCCTCGATGAC
TTCGCGGCCCGTTCGATGGCCAGCACCACCGATCAGGCGTTCATCTGCCACGCCATAGAACGGGCCATCG
ACGACCACGAGCCTCGGCTTCGCAATGTCCGTGTCCAGCTCAATCCGCGCGAAGTGTCCAAGCAGAACTT
GAAGTTCACTATCCGCGCGATGCTGAAGGTGCACCCGATGCAGGCGCCGGTCAACTTCGACGCCATGCTT
CAGACCAGCACGCAGCAGTATGCGGTGACCGCCGCCCGCCGCCCTGCGGCCGAGACTGCGCCATGA