SecReT6
Protein ID: 383758427
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25740
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2710561..2711100 [-]
Producthypothetical protein
NoteTssD
UniProt IDI0HSC6
KEGG IDrge:RGE_25740
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.90E-37, Aligned region: 6..150
Protein Sequence: 179 a.a.     [Download]
>gi|383758427|ref|YP_005437412.1| hypothetical protein RGE_25740 [Rubrivivax gelatinosus IL144]
MKDIYVVFKNSDIKGETRDSKHAAEYGIEVGSFEHRIQQPKSAAASSSGGHTAERTEHGEMIFTKEIDSA
STKLWQASSAGTVYKDVDIYFYRAFGGQDKTQSGTKRVNYLKIQLKNVVVSSVSTNIVSGTELPTEVFGL
KYSAVQWTYNEAPLDGASAKNTNVQGMWNLKTNDVSFAG
 
Nucleotide Sequence: 540 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2711100-2710561 Rubrivivax gelatinosus IL144, complete genome
ATGAAGGACATCTACGTCGTTTTCAAGAATTCCGACATCAAGGGCGAGACCCGCGATTCCAAGCATGCCG
CGGAGTACGGCATCGAGGTCGGTTCGTTCGAGCACCGAATCCAGCAGCCGAAGTCGGCTGCCGCCTCATC
CTCAGGCGGCCACACCGCAGAACGCACCGAGCATGGGGAGATGATCTTCACGAAGGAGATCGATTCCGCC
AGCACCAAGCTCTGGCAAGCCAGTTCGGCCGGCACCGTCTACAAGGACGTGGACATCTACTTCTACCGTG
CCTTCGGCGGCCAAGACAAGACGCAGAGCGGCACGAAGCGCGTGAACTACCTGAAGATCCAGCTCAAGAA
CGTGGTGGTGTCATCGGTATCCACCAACATCGTCAGCGGCACCGAGCTGCCGACCGAGGTCTTTGGCCTC
AAGTACTCGGCGGTGCAATGGACCTACAACGAGGCCCCGCTCGACGGCGCCTCGGCCAAGAACACCAACG
TCCAAGGCATGTGGAACCTCAAGACCAACGACGTTTCGTTCGCGGGCTGA