SecReT6
Protein ID: 383758428
SecReT6 ID565
T6SS typei4b
Gene symbol-
Locus tagRGE_25750
StrainRubrivivax gelatinosus IL144
Repliconchromosome [GenBank: NC_017075] [Browse all T6SS(s) in this replicon]
Location [Strand]2711152..2712630 [-]
Producthypothetical protein
NoteTssC
UniProt IDI0HSC7
KEGG IDrge:RGE_25750
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.60E-196, Aligned region: 64..487
Protein Sequence: 492 a.a.     [Download]
>gi|383758428|ref|YP_005437413.1| hypothetical protein RGE_25750 [Rubrivivax gelatinosus IL144]
MSQAALQVQPPAAEGSLLDQIVSASKVARSEAEHTHAKDIIAELVREVLGGTVVVSENLSVTLDARVAEL
DRLISEQLSEVMHHVDFQNLESSWRGLHYLCKQTSTGSTLKIQVLNATRKELVKDFQAAVDFDQSALFKK
VYEEEYGTFGGAPFGALIGDYAITRQPEDMYFLEQMSHVAAAAHAPFISAASPQLFGLESFDELGRPRDL
SKVFDSVEYAKWRSLRESEDSRYVGLTVPRFLGRLPYNPKDGTTTEGFNFIENVDGSDHSKYLWVNTAYA
MGARLTSAFEKYGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFIPLVH
CKNTDYAAFFGAQSSQKARKYDSDSANANAVLSSQLQYMFAVCRIAHYMKAMMRDKIGSFASASNVQEFL
NAWIRQYVTTDDNATQEVKAAYPLREASVEVSEVPGRPGVYRAVSFIRPHFQLDELTVSLRLVAELPQGR
KG
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|383755859|ref|NC_017075.1|:c2712630-2711152 Rubrivivax gelatinosus IL144, complete genome
ATGTCTCAAGCAGCACTCCAAGTCCAGCCCCCCGCGGCCGAAGGCAGCCTGCTCGACCAGATCGTCAGCG
CCAGCAAGGTTGCGCGCTCCGAGGCCGAGCACACGCACGCGAAGGACATCATCGCCGAACTCGTGCGCGA
GGTGCTCGGAGGCACGGTCGTCGTTTCGGAGAACCTGAGCGTCACGCTGGATGCCCGCGTGGCCGAACTC
GACCGCCTGATCTCCGAGCAGCTGTCGGAGGTGATGCACCACGTCGACTTCCAGAATCTCGAGTCGAGCT
GGAGAGGTCTGCACTACCTTTGCAAGCAGACTTCCACTGGCTCGACGCTGAAGATCCAAGTCCTCAACGC
GACCCGCAAAGAACTGGTCAAGGACTTCCAGGCTGCGGTCGACTTCGACCAGAGCGCACTTTTCAAGAAG
GTCTACGAAGAAGAGTACGGCACCTTCGGCGGCGCGCCGTTCGGGGCCCTCATTGGCGACTACGCCATCA
CGCGCCAGCCCGAAGACATGTACTTCCTGGAGCAGATGTCGCATGTGGCCGCGGCCGCGCACGCGCCGTT
CATCAGCGCTGCATCGCCCCAGTTGTTCGGTCTGGAGAGCTTCGACGAACTGGGGCGGCCGCGCGACCTG
TCCAAGGTGTTCGACTCGGTCGAGTATGCGAAGTGGCGCTCGCTGCGCGAATCCGAGGACTCTCGCTACG
TCGGCCTCACGGTTCCACGCTTTCTGGGCCGGCTGCCGTACAACCCGAAGGACGGTACGACGACCGAAGG
CTTCAACTTCATCGAGAACGTCGACGGCTCCGACCACAGCAAGTACCTGTGGGTCAACACTGCCTACGCG
ATGGGCGCCCGGTTGACTTCGGCCTTCGAGAAGTACGGCTGGTGCGCGGCCATTCGCGGCGTCGAAGGCG
GGGGGCTGGTGGAAGACTTGCCGACGCACACCTTCAAGACCGATGACGGCGAGGTGGCGCTGAAGTGCCC
CACCGAGATCGCCATTACCGATCGCCGCGAGAAGGAGTTGAGCGACCTCGGTTTCATCCCGCTGGTGCAC
TGCAAGAACACCGACTACGCCGCGTTCTTCGGTGCTCAGTCGTCGCAGAAGGCCCGGAAGTACGACAGCG
ACAGCGCCAACGCGAATGCCGTGCTGTCGTCCCAGCTGCAGTACATGTTCGCGGTCTGCCGCATCGCGCA
TTACATGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCGGCAAGCAATGTCCAGGAGTTTCTG
AATGCCTGGATCCGGCAGTACGTGACCACCGACGACAACGCCACGCAGGAAGTGAAAGCCGCTTACCCGC
TGCGAGAGGCCAGCGTCGAGGTGAGCGAGGTTCCTGGCCGCCCAGGCGTGTATCGGGCCGTCAGCTTCAT
CCGTCCCCACTTCCAGCTCGACGAACTGACAGTATCCCTGCGTCTGGTGGCCGAGTTACCGCAGGGGCGC
AAGGGTTAG